[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38484.1


[Show Plain Result]

## Summary of Sequence Search
   1::489
 240::488  PF02913 0.0% 29.4605809128631  FAD linked oxidases, C-terminal domain 
  67::203  PF01565 0.0% 42.962962962963  FAD binding domain 
   1::489


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGGRGQNQARRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNLYRGHSPLVLR
PF02913         ----------------------------------------------------------------------
PF01565         ------------------------------------------------------------------avvr


                         -         -         *         -         -         -         -:140
query           PGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQ
PF02913         ----------------------------------------------------------------------
PF01565         peseeevaaivrlarekglpvlvrGgGssll.gqav.tggvvldlsrlnrileideeegtatveaGvtlg


                         +         -         -         -         -         *         -:210
query           HAQERAASVDRLFPLSLGAQGSCTIGGNLSTNAGGTAALAYGLARDMALGLEVVLADGRILNLLSKLKKD
PF02913         ----------------------------------------------------------------------
PF01565         dleealaakglllglepgslipgtvGGaiatngggygsekyGlirdnvlslevvladGevvrl-------


                         -         -         -         +         -         -         -:280
query           NTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAE
PF02913         -----------------------------lpeavavavlgfpsfeaavkavrelass.glgpaalelmdk
PF01565         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IALDFSVRHGHNRDPLQSRHPWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKL
PF02913         aaldlvlatkgl.kglpdeeealllvefegddeevdeerveaavealleatgagdvvvaqdeaeqerlwr
PF01565         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           REEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA
PF02913         arksalpylrdallgagalvftedtsvplselpdlvaeikellakyg..lvvvlfgHvgdgnlhlyilfd
PF01565         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKVL-
PF02913         akdeeeeeraeelvdev....idliaalgGsisgeHGvGldkkawlkeekgeeglalmrriKaalDPn--
PF01565         ----------------------------------------------------------------------