[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38488.1


[Show Plain Result]

## Summary of Sequence Search
   1::339
 164::302  PF00107 0.0% 42.96875  Zinc-binding dehydrogenase 
  28::93   PF08240 0.0% 39.3939393939394  Alcohol dehydrogenase GroES-like domain 
   1::339


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDVAGEI
PF00107         ----------------------------------------------------------------------
PF08240         ---------------------------pgevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGiv


                         -         -         *         -         -         -         -:140
query           VKVGEGVEGWKAGDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTA
PF00107         ----------------------------------------------------------------------
PF08240         eevgegvkklkvGdrvvveplis-----------------------------------------------


                         +         -         -         -         -         *         -:210
query           HRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
PF00107         -----------------------GvGlaavqlAkalGarviavdsseeklelakelGadhvinskdedfv
PF08240         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
PF00107         kaireltgg...........kgvdvviecvgagatfeqalkllapgGrvvvvggtsganvefdlrklllk
PF08240         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LQVRGSNGWERDDIEKLFALLASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP-----------
PF00107         ektiqGsllgnpeeleealqll------------------------------------------------
PF08240         ----------------------------------------------------------------------