[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38511.1


[Show Plain Result]

## Summary of Sequence Search
   1::795
 477::522  PF01479 0.0% 47.8260869565217  S4 domain 
 537::669  PF00849 0.0% 26.3157894736842  RNA pseudouridylate synthase 
   1::795


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRDTDKNNASARGRRDRPGGGKTSSGGKGGFGGKGGFGGKSAGGGKGRSGAARGPEKKFAKRGEGTFEA
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RADKPFAKKTFGGDAKRAFGGEGKRPYVKRDGAAPRRDFADRPRRDDGDAPRPRFNRDERPARSGGDRPE
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RGPRKEFGEKRAFAPREGGEKRPYTPRPPRDDRGGDRPFKRDDRAPRRDRGDDARPAGRFGDKKFGDKKF
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEKRPYTPREGGDKRPYTPREGGEKRPYTPREGGEKRPYAAREGGEKRPYTPRDGGEKRSYAPREGGDKR
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PYTPRGEGFRKDGERSRPTGDRPFGARPSRDGKFGGDKKFGRGAPDRGPRKDFGSRPDRGGDRGDAKPWQ
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KRDGDSAERGRSFDKPRFDKPREERGGDRPRFSRDDRPKFERRERTGDWHEHPRNEGPSSDRPRSRDNGE
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RGFDRPRRENEDESKIFAKRPAFGGRGAYRERPKTDRSKTERRAAPAPAKADKAGDRIAKVVARAGLCSR
PF01479         --------------------------------------------------------RLDkvLarlglass
PF00849         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLYHKPRGLMTTHADPEGRPTVF
PF01479         rseArqlIehGhVrVNGkvvkdpsyrVkpgDv--------------------------------------
PF00849         ----------------------------------------------lvvvnKPagvpvtpeakggsekek


                         -         -         -         *         -         -         -:630
query           DNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPETGWLRRYRVRAHGEVTQAQLDQLASGVEVD
PF01479         ----------------------------------------------------------------------
PF00849         sttatssraeeekkelklvhRLDkaTsGllllAksgeaaaklakafeerkvrKkYlalvfgapleeegai


                         -         +         -         -         -         -         *:700
query           GVKYGPIEAKLERDQGANVWLVFAIREGKNREVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVKT
PF01479         ----------------------------------------------------------------------
PF00849         kskiskdtekqegarrkkeeldgkkavtylrvlesgskt-------------------------------


                         -         -         -         -         +         -         -:770
query           RVLREQLGEKIIKLAEADFGGPSPSETRPKPRPGKPVAAEDGPAPKKKAVVKRGAVEDRKGRKVKVERTG
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           SGDRDPSRGPARRYHGKREPAPRED---------------------------------------------
PF01479         ----------------------------------------------------------------------
PF00849         ----------------------------------------------------------------------