[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38586.1


[Show Plain Result]

## Summary of Sequence Search
   1::586
  96::264  PF07167 0.0% 47.6190476190476  Poly-beta-hydroxybutyrate polymerase (PhaC) N-termi 
  24::62   PF12551 0.0% 64.1025641025641  Poly-beta-hydroxybutyrate polymerase N terminal 
 269::503  PF00561 0.0% 21.1538461538462  alpha/beta hydrolase fold 
 299::400  PF00975 0.0% 24.4444444444444  Thioesterase domain 
   1::586


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLQTPSNPIAVAPQAPVRHVGSTDSDRSLHAALAPLTGGLSPTALSLAYADWLSHLFWAPARRLDLAQDA
PF07167         ----------------------------------------------------------------------
PF12551         -----------------------alDralhAalArlTgGlSPaalalAylDWalHLavSPgK--------
PF00561         ----------------------------------------------------------------------
PF00975         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LRGAAQLAQAAVHPAPPWSLITPQPQDRRFAGPEWRQPPFNLMAQSFLLAEEWWRDATTGIRGVSQQNAK
PF07167         -------------------------kdrRFadeaWeenplfdllkqaYlltakaleelveevegldektr
PF12551         ----------------------------------------------------------------------
PF00561         ----------------------------------------------------------------------
PF00975         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IVEFAMRQMLDVFAPSNFALTNPEVIRRTLTSEGGNVTAGLRNWWEDLLQTMSHDTDLKHDFEVGRDVAV
PF07167         erveflvrqlidalaPsNflatNpealkealeskGeslvrGlenlleDleegkgkisqtd.esafevGkn
PF12551         ----------------------------------------------------------------------
PF00561         ----------------------------------------------------------------------
PF00975         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TPGKVVYSNDLIELIQYAPATGEVRPEPILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPT
PF07167         lattpGkvvfrnelleliqYkpttekvlkrPllivPplinkfYildLkpenSlv----------------
PF12551         ----------------------------------------------------------------------
PF00561         ----------------------------------------------------------fdviglDlrGvg
PF00975         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AKHRDLTLEDYRRLGVMAAIETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRDGDDRLRSITLFAAQTD
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF00561         ySspaggpelphyttddlakdleavldalglkkltlvGhSmGGmialayaa.eypd...rvkamvllgtv
PF00975         ------------------yaealrqiqpegPyaLfGySlGGllAfevArqLerq.geevasLiliDapap


                         -         -         -         -         *         -         -:420
query           FTEAGELTLFINESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWN
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF00561         a.................svlsdglssdvlnr....gstltlladnvagrlskgikplqgdasvqaqsll
PF00975         sekakeashllgdee...........lvaelrdiggtpealledeellse--------------------


                         -         -         +         -         -         -         -:490
query           ADATRMPYRMHSEYLRKLFLDNDLAEGRYTVDDRAIALSDIHTPMFVVGTLRDHVAPWRSTFKIHLLADA
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF00561         rpqvtdflkrfdansyiregetraldgkllaalgrdlvwdvtetlstilvptlvisgtdDplvpykasek
PF00975         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EITFCLTGGGHNAGIVSPPSPKAHGYQVMMKEADGPYIGPDDWIKEAPHAEGSWWTEWVHWLEARSGQPV
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF00561         laelipk..sqlv---------------------------------------------------------
PF00975         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PPPRIGLPDTNAAELPDAPGHYVLQA--------------------------------------------
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF00561         ----------------------------------------------------------------------
PF00975         ----------------------------------------------------------------------