[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38720.1


[Show Plain Result]

## Summary of Sequence Search
   1::180
   6::134  PF00903 0.0% 26.6666666666667  Glyoxalase/Bleomycin resistance protein/Dioxygenase 
   1::180


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
PF00903         -----idhvalavgdleksldFYtkvLGfklvkktdn......teeteglriaffhaggghielvlneap


                         -         -         *         -         -         -         -:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTAT
PF00903         sgaakhvkkiee...tvhhvafialdvedvgkaldrlkeagvkvvaepgrhyfgalysfyfrDp------


                         +         -         -         -         -         *         -:210
query           PQQLAQMKDVAHAMVDEWAETKKPPRHTAWLHQKEFADAK------------------------------
PF00903         ----------------------------------------------------------------------