[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38828.1


[Show Plain Result]

## Summary of Sequence Search
   1::372
  13::367  PF01717 0.0% 23.6593059936909  Cobalamin-independent synthase, Catalytic domain 
   1::372


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQRTKAPFRADEVGSLLRPQSIKDARARLEKGEISAADLRRIEDMEIEKIVHKQSAIGLKLATDGEFRRS
PF01717         ------------iGSfPqtaevrearaelkkgkiseeeyekaikeaiekavreqeelgvDvlvdgeaeRg


                         -         -         *         -         -         -         -:140
query           WWHFDFLSHLTGCELYHPDTGIQFAGVQTRNDSIRVIGKLDFPDDHPMLEHFRFLKRHADIAHVTAKMTI
PF01717         dmveyfgealegf.aktkngwvqsygsrvvrppi.ivgdvirkkp..ltvkesalaqsttskevkglltG


                         +         -         -         -         -         *         -:210
query           PSPAVLHFRGGRKAISSEVYPDLDGFFEDLARTYRKAVKAFYDAGCRYLQFDDTVWAYLCSQDELQKARE
PF01717         pv.tilewsfvr......edvdreelimqialalrkevkaLekagikviQiDEP....alreglplkk..


                         -         -         -         +         -         -         -:280
query           RGDNPDNLQQIYSRVINYAIAERPSDMVITTHVCRGNFRSTWISSGGYEPVAETLLAGINYDGYFLEYDS
PF01717         .edwaayldwavaafrldtivaa..ldiqvalHvCysefndil...........deisaldvdvltleaa


                         -         *         -         -         -         -         +:350
query           ERAGGFEPLRFLPKGNKVVVVGVITSKFGELEKKDDIKRRLDEAAKFAPLAQLALSPQCGFASTEEGNIL
PF01717         rsdkealealee.akyekkvglGvvdvhsprvpsveeikalikkvldvalkdrLwvnPdCGlkt......


                         -         -         -         -         *         -         -:420
query           SEQEQWDKLRLAVEVAQDVWGR------------------------------------------------
PF01717         rkreeaiaaLknmveaa-----------------------------------------------------