[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39200.1


[Show Plain Result]

## Summary of Sequence Search
   1::95
   7::77   PF01541 0.0% 37.1428571428571  GIY-YIG catalytic domain 
   1::95


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSILEARTREHVLK
PF01541         ------vYiivnkknkvlYiGstnnlerRlkeHnagkesketkqkkygkdkfelt.iveeirtkqealel


                         -         -         *         -         -         -         -:140
query           RWRRDWKIALIEKLNPDWRDLSNDL---------------------------------------------
PF01541         Ekelikk---------------------------------------------------------------