[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39205.1


[Show Plain Result]

## Summary of Sequence Search
   1::431
 143::428  PF05065 0.0% 42.5855513307985  Phage capsid family 
   1::431


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNPFFIITTRDHMMTTTFDHAPETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEKRGGDVIAEDK
PF05065         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VARIDAALNAQQRRLDELALKQARPQLGADSALRPRGAAEHKSAFDAYIRNGDAATLRQIETKALSVGSN
PF05065         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PDGGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYKKPFMTAGPATGWVGEAAARPQTSSPTLDAL
PF05065         --ggylvpeeisteiiellreesslrqlvtvepvttstsgsltilkrtngaeagwvgEgga.pktdtpkf


                         -         -         -         +         -         -         -:280
query           SFPAMELYAMPAATATLLDDAAVNLDDWLTGEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSW
PF05065         gevtlkvkklaalvpisnelLddsaidleayladelaeaiarkedaailnGdgtgtgqpkGilas.....


                         -         *         -         -         -         -         +:350
query           GNLGFVATGAAGAFPASNPSDVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASG
PF05065         .......tgatavttaaasktaag.ntlddlvdllnvsldaayranatwvmnpstlaalrklkdanGryl


                         -         -         -         -         *         -         -:420
query           RASLIGFPLADAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF
PF05065         lqpslaagtp.tllGlpvvvtedm....ap.geilfGdf.sayiivdregvtversdd..ddfeknqvaf


                         -         -         +         -         -         -         -:490
query           DAIKLLKFGGS-----------------------------------------------------------
PF05065         raeervdg--------------------------------------------------------------