[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39246.1


[Show Plain Result]

## Summary of Sequence Search
   1::526
 308::392  PF00595 0.0% 26.3157894736842  PDZ domain (Also known as DHR or GLGF) 
 435::486  PF00595 0.0% 38.7755102040816  PDZ domain (Also known as DHR or GLGF) 
 144::300  PF00089 0.0% 24.5161290322581 PF00089 Trypsin 
   1::526


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDRNTDLPSQPSRQPDRRSLLSARKFALMASVVAGLGAGAFGLSQTSTPVDLFSTPAHAQVGNKVNQAQ
PF00595         ----------------------------------------------------------------------
PF00595         ----------------------------------------------------------------------
PF00089         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QPVGFADIVEKVKPSVISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFRRFGGEMPPGMRGHRGGGTMT
PF00595         ----------------------------------------------------------------------
PF00595         ----------------------------------------------------------------------
PF00089         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTDFPFAKLSEGK
PF00595         ----------------------------------------------------------------------
PF00595         ----------------------------------------------------------------------
PF00089         ---gGslisen.wvLTAaHcvknasdvkvvlgehnlkksegkeqklkvekvilhpnynpstlnDiallkl


                         -         -         -         +         -         -         -:280
query           PRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAI
PF00595         ----------------------------------------------------------------------
PF00595         ----------------------------------------------------------------------
PF00089         kepvklgdtvrpiclpaassslkvgttclvsGwgrtkekgksdtlqevevpvvsretcksayggkvtenm


                         -         *         -         -         -         -         +:350
query           YSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGP
PF00595         ---------------------------leke.krgglGfslkggsdkr........dkgifvsevvpgga
PF00595         ---------------------------leke.krgglGfslkggsdkr........dkgifvsevvpgga
PF00089         lcagakggkdacqGDSGGPl--------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAKAGIESGDVITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVNDG
PF00595         aeagglkeGDkIlsvNgvdvenvshdeavqaikgkkgevtLt----------------------------
PF00595         aeagglkeGDkIlsvNgvdvenvshdeavqaikgkkgevtLt----------------------------
PF00089         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GDNGNSSSRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDV
PF00595         --------------glGfslkggsdkr...dkgifvsevvpggaaeagglkeGDkIlsvNgvdven----
PF00595         --------------glGfslkggsdkr...dkgifvsevvpggaaeagglkeGDkIlsvNgvdven----
PF00089         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           REAINTAKADNKNSVLIRVRSGGSSRFVAVPISAKG----------------------------------
PF00595         ----------------------------------------------------------------------
PF00595         ----------------------------------------------------------------------
PF00089         ----------------------------------------------------------------------