[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39396.1


[Show Plain Result]

## Summary of Sequence Search
   1::313
  38::206  PF01068 0.0% 30.7692307692308  ATP dependent DNA ligase domain 
 222::309  PF04679 0.0% 37.5  ATP dependent DNA ligase C terminal region 
   1::313


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKRARVVRIHAEGAVPAPMPGFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHD
PF01068         -------------------------------------egafiveeKyDGeRvqvhkdgdevkllSRrgkd
PF04679         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WSKMFAPLVAALSDAAVDEAVIDGEIVVVVDERTDFGALQADLAARRADRMLFYAFDLLHLDGYDLGPVP
PF01068         itakkpellkalkeaflkdvksvildGElvavdketgeilpfqtlasrknkkkvkveekeaelsffvFDv
PF04679         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKR
PF01068         lyldgesltdepleeRrklLeeifkesenrieiaetlevndveeleelleevikeglEGvvlKdpd----
PF04679         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETAAPPIAKPPPRHRPR
PF01068         ----------------------------------------------------------------------
PF04679         -----------rggvgslllgvyddeegklryvgkvgtGfsdaeleelrkkleplerkkspfdekvkaer


                         -         *         -         -         -         -         +:350
query           WVRPVMSADVEYRDITASGHLRHASFKGLAKAP-------------------------------------
PF01068         ----------------------------------------------------------------------
PF04679         pdvwvePelVaevkfaeitksgrlRfPrf-----------------------------------------