[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39446.1


[Show Plain Result]

## Summary of Sequence Search
   1::281
  17::269  PF00248 0.0% 36.9047619047619  Aldo/keto reductase family 
   1::281


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSWDTRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
PF00248         ----------------elglGtwslgsdeisedealellraaleaGinlfDtAevYgkgkseellgealk


                         -         -         *         -         -         -         -:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
PF00248         ksrvkreeviiatKvdgriapqseglsrenirksleesLkrlgtdylDllllHrpdpslpieevlealee


                         +         -         -         -         -         *         -:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
PF00248         lkkeGkiryiGvSnfsveileka.lkkkkvkivvvqveynllrrlaeegllelcaekgvgiiaysplggG


                         -         -         -         +         -         -         -:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKAADAAHAADNAAAASLRLSDEEIAAIDQAFPLGPEPASLPM
PF00248         lltgkyeseedkedkeprkdknqealeelselakehgvsiaqlalryalsrpavgvvip-----------


                         -         *         -         -         -         -         +:350
query           L---------------------------------------------------------------------
PF00248         ----------------------------------------------------------------------