[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39477.1


[Show Plain Result]

## Summary of Sequence Search
   1::152
  53::127  PF03061 0.0% 36  Thioesterase superfamily 
   1::152


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRESVFWKIADGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFLAAMLDDTMGP
PF03061         ----------------------------------------------------GivhgGvylalldeaagl


                         -         -         *         -         -         -         -:140
query           ALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVATGTATAVIRRMG
PF03061         alrslggsgqgvvvvelnidFlrpvrlgdvltvearvlrlgrtsavvevevrdedgr-------------


                         +         -         -         -         -         *         -:210
query           TQTAWAAAQKPA----------------------------------------------------------
PF03061         ----------------------------------------------------------------------