[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39592.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
 130::247  PF01614 0.0% 33.8983050847458  Bacterial transcriptional regulator 
  11::57   PF09339 0.0% 34.0425531914894  IclR helix-turn-helix domain 
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTDEASPGPLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAGRSYYVGE
PF01614         ----------------------------------------------------------------------
PF09339         ----------ldRalaiLdalaeapqelslselArrtglpkStvhRlLqtLvelGyv-------------


                         -         -         *         -         -         -         -:140
query           RLTRLLHAGADDGWYASLAGPHLRALTEASTETCYLARLIGSRVVVALSYSPDVRWRGYVQPGIEMPVNA
PF01614         -----------------------------------------------------------srvGarlplya
PF09339         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRL
PF01614         taiGKalLAaldeeeleavleklelkrltrrtitdleaLleeLaavreqGyavdreEeeegvasiAapvf
PF09339         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PNGAVLHSVGMTGPLERIMNKQLSTRLAALRATAATLAKALALGSTIKQRSSS-----------------
PF01614         dasgevvaAvsvsgptaRlteeelkeellallreaar---------------------------------
PF09339         ----------------------------------------------------------------------