[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39597.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
  41::162  PF00005 0.0% 32.7586206896552  ABC transporter 
 215::234  PF12399 0.0% 50  Branched-chain amino acid ATP-binding cassette tran 
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST
PF00005         ----------------------------------------STLlklltgelkptegeievdn.drkdles
PF12399         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGE
PF00005         dkleklrigyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvgldelldksrvstLSgGq
PF12399         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET
PF00005         kqrvalArallkkpklllLDEP------------------------------------------------
PF12399         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRIVLEGPASELKHNARVREAYLGR---------------------------------------------
PF00005         ----------------------------------------------------------------------
PF12399         ----AeGtPeEvrndPrVieAYLG----------------------------------------------