[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39673.1


[Show Plain Result]

## Summary of Sequence Search
   1::441
 211::427  PF01520 0.0% 39.8843930635838  N-acetylmuramoyl-L-alanine amidase 
  52::140  PF11741 0.0% 31.4606741573034  Localisation of periplasmic protein complexes 
   1::441


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRGRDSLSGRANHFVLFRAILACAAALLCAAPTAGVAGEAVATSAPAPTSFPIAAEVRLAGDDTQTRFV
PF01520         ----------------------------------------------------------------------
PF11741         ---------------------------------------------------avqitavrvwptdkgtrlv


                         -         -         *         -         -         -         -:140
query           IDLDRTVPMRAFALADPYRVVIDLPQVNFRLPAASGGTGRGLIKAYRYGLVMPGGSRVVLELSGPAKITK
PF01520         ----------------------------------------------------------------------
PF11741         letsggvqlqvftlsnpnrlviDipnaqlnlplgelatfrqendpgIksvrvgqfdantvRivvelektl


                         +         -         -         -         -         *         -:210
query           ADMLEAANGQPARMVIELGSVDRTAFVESLGVEKGPELRPAIGAADATSSVPHRVESPKLDAAKDDLRPV
PF01520         ----------------------------------------------------------------------
PF11741         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IVLDPGHGGIDNGTQSQSGVSEKALVLEFALALRDQMEKGGKYRVVLTRTDDTFIPLNDRVKIARAHSAA
PF01520         ividpGHggkdpGavgknglkEkdlnlkvakklakllekkg.vevvltrdsdsnlslkervelansakad
PF11741         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LFVSIHADALPRGEGDAQGATIYTLSDKASDAEAQRLADAENKADAIGGVNLTEEPTEVADILIDLAQRE
PF01520         lfvsiHanaaansa..asGvevfy.........................................sekne
PF11741         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TKTFSNRFAQTLMREMKSATRLHKQPLKSAGFRVLKAPDVPSVLLELGYVSNKGDLKQLVSEQWRTKTVG
PF01520         ksaeskrlakailkelkkklglknrgvkkasnlavlrktkmpavlvElgfisnpedakllkseeyqqkia
PF11741         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AVALAIDSFFAKRLVSAGKPD-------------------------------------------------
PF01520         kaiaegi---------------------------------------------------------------
PF11741         ----------------------------------------------------------------------