[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39735.1


[Show Plain Result]

## Summary of Sequence Search
   1::351
  20::344  PF00152 0.0% 25.1724137931034  tRNA synthetases class II (D, K and N) 
   1::351


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQGGTFASPWWDPARYLDRKPFLRARSAVTRAARDWFAAAEFAEVETAILQLSPGNETHLHAPRTEFKGP
PF00152         -------------------qknlklrskvikairefldergFleveTPiLtkstpeg.....aardflvp


                         -         -         *         -         -         -         -:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVIADCAAL
PF00152         kfyakeayLpqSpqlykqllmvaGfdrvfqiarcFRdEdlradrhppEFtqldlemsfvdeedvmklvee


                         +         -         -         -         -         *         -:210
query           IALAARTTGIGQFSFRGRTADPQAEPEMLTVAAAFARFAGIDLLATIIGGEGDRDALARAAAAKVRVADD
PF00152         llkevfkevk....lkl...gvelkkpfpritykeaiekygsdk.pdlrfel..elkdvteikkse....


                         -         -         -         +         -         -         -:280
query           DNWSDIFSKVLVDHIEPRLGEGRLTVLCEYPAPEAALARTKADDPRVAERFEVYACGVELANGFGELTDA
PF00152         ............galreelaeeklvkekkskplfvvdfPlfkrpftkpkeedeealaeayDlvlngvElg


                         -         *         -         -         -         -         +:350
query           AEQRLRFTASMDEKERRYGERYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPPADEA
PF00152         gGsirihdpeeqekrfeeqglk....eeeaeekfgfllealkyGapphgGialGlDRlvmlltg------


                         -         -         -         -         *         -         -:420
query           S---------------------------------------------------------------------
PF00152         ----------------------------------------------------------------------