[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39945.1


[Show Plain Result]

## Summary of Sequence Search
   1::346
  46::195  PF00004 0.0% 24.7524752475248  ATPase family associated with various cellular acti 
   1::346


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSARKAAADIVAKLPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYRMARFVLAHRD
PF00004         ---------------------------------------------lyGppGtGKTllakavakelgve..


                         -         -         *         -         -         -         -:140
query           PLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVITVDESRETIGFFGSTAAVEGW
PF00004         ........................fleisgsellsk.......................yvgesekkire


                         +         -         -         -         -         *         -:210
query           RVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPARVLPTIQSRCRKLMLRPLATADVIAAAVAA
PF00004         lfkeakekapsvlfiDEidalaksrgseseeeervvnqLlteldglkkkeskvlv---------------


                         -         -         -         +         -         -         -:280
query           TDLAPGDPKLADAAAASEGSVSRALTLLGGDALTLHQKTTALLDSLPNVDPRALHALGESIGGTDRATLA
PF00004         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AFVDGVDRWIAQRLRAGDANANLPRLARLAEVWEKIGRAARDTEAYNLERKPLVFSVFGLLAEAVR----
PF00004         ----------------------------------------------------------------------