[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE39967.1


[Show Plain Result]

## Summary of Sequence Search
   1::139
  33::121  PF00816 0.0% 28.0898876404494  H-NS histone family 
   1::139


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRNRSADLIPSRWEGAVKDIDPDAMTVDELWEIHERISQVLCSKIQSEQRKLDGHLSRLRLGVTSGANQ
PF00816         --------------------------------eLealieklekeaeeaekrekkaalaeirelaaeyglt


                         -         -         *         -         -         -         -:140
query           QSDDESGPKPARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGKSIDDFLIRAKPSNVRKKRR-
PF00816         leelaagaakkkakkkrakvpaKYrnpetngetWsGrGrkPkwlkaalaag-------------------