[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE40018.1


[Show Plain Result]

## Summary of Sequence Search
   1::79
   4::53   PF02416 0.0% 28  mttA/Hcf106 family 
   1::79


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDPVKSIDHNAPTAAAPT
PF02416         ---lgapelliIlvValllFGpkkLPEvaraLGktLreFkkavkeleeeneke-----------------


                         -         -         *         -         -         -         -:140
query           RTDVGSKAV-------------------------------------------------------------
PF02416         ----------------------------------------------------------------------