[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE40040.1


[Show Plain Result]

## Summary of Sequence Search
   1::344
  39::335  PF00676 0.0% 48.122866894198  Dehydrogenase E1 component 
 133::220  PF02775 0.0% 23.4567901234568  Thiamine pyrophosphate enzyme, C-terminal TPP bindi 
   1::344


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAAPKKSAAKETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
PF00676         --------------------------------------klmllrrmedalaalykrkkrigfvhlsagqe
PF02775         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTGRRGGYSKGKGGSMHMFSMEKHFYGGHGI
PF00676         alqvgiaaalekeDlvistYRehgvllargvsleevlaeltgke....kgkggsmheisyaekksrflgg
PF02775         --------------------------------------------------------------syltsggl


                         +         -         -         -         -         *         -:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
PF00676         ngivgaqvplvaGialaakyegkkevailliGDGatnqGqffealnlAalwklpvifvveNNqyaistea
PF02775         gtmGyglpaAiGakla....kpdrevvaivGDGgflmi.lqelatavrr.nlpitvvvlnNegygmtggq


                         -         -         -         +         -         -         -:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
PF00676         erssaskelakkargvgipgirVdGnDvlAvyqAvkeAaeraregkgPvLielvtYRyggHsesDdpsty
PF02775         .qepfggkrk------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYR------
PF00676         rtreeveevrkkkdpikrlkehlvkkgvvseeelkeiekevrkeieeavkkaeek---------------
PF02775         ----------------------------------------------------------------------