[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE40088.1


[Show Plain Result]

## Summary of Sequence Search
   1::217
  40::82   PF00440 0.0% 34.8837209302326  Bacterial regulatory proteins, tetR family 
   1::217


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAARCTLRPRFWPQASIAKSCGSESDTRMPRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRA
PF00440         ---------------------------------------IldaAlelfaekGyaattvreIAkeAGvskg


                         -         -         *         -         -         -         -:140
query           ALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGDTQE
PF00440         alYrhFpsKeeL----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PALRALALERNELVRGAIERRLPSEPHNPEQASGLVQAVIQGACMQWLIARNGPLDAFMTEQTRQVLSVL
PF00440         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YPGHTFE---------------------------------------------------------------
PF00440         ----------------------------------------------------------------------