[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE37468.1


[Show Plain Result]

## Summary of Sequence Search
   1::89
   2::89   5.6e-29 53.4% 0037893 00378931 1/1   S1 RNA-binding domain                   
   3::87   4.9e-28 54.1% 0034846 00348461 1/1   S1 RNA-binding domain                   
   2::87   7.8e-27 53.5% 0036463 00364631 1/1   S1 RNA-binding domain                   
   1::89


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
00378931   1/1  -altgekkqeilkefglaegdtGslevqlalltarivnltehlelnkkDkhskrgllllvskrrrllkYl
00348461   1/1  --ltgekkqeilkefglaegdtGslevqlallterivnltehlelnkkDkhskrgllllvskrrrllkYl
00364631   1/1  -altgekkqeilkefglaegdtGslevqvalLtarivnltehlelnkkDkhskrgllllvskrrrllkYl


                         -         -         *         -         -         -         -:140
query           KKKDEARYKALLEKHNIRR---------------------------------------------------
00378931   1/1  krkdvlryewlieklglrr---------------------------------------------------
00348461   1/1  krkdvlryewlieklgl-----------------------------------------------------
00364631   1/1  krkdvlryealiakLgl-----------------------------------------------------