[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE37597.1


[Show Plain Result]

## Summary of Sequence Search
   1::426
 169::423  2.2e-68 43.9% 0042443 00424431 1/1   ouridine synthase                       
 178::426  6.8e-65 44.9% 0050102 00501021 1/1   ouridine synthase                       
 183::391    4e-43 43.9% 0050199 00501991 1/1   ouridine synthase                       
 182::395  2.7e-42 41.9% 0043606 00436061 1/1   ouridine synthase                       
 185::404  8.4e-39 45.6% 0047872 00478721 1/1   ouridine synthase                       
 143::417  5.7e-36 23.1% 0052542 00525421 1/1   ouridine synthase                       
 113::213  7.4e-20 33.0% 0035794 00357941 1/1   -L RNA-binding motif                    
 156::412  5.5e-13 21.0% 0051811 00518111 1/1   ouridine synthase                       
 113::213  8.8e-10 24.8% 0037616 00376161 1/1   -L RNA-binding motif                    
 108::212  1.3e-09 24.0% 0036496 00364961 1/1   -L RNA-binding motif                    
 111::169  4.6e-09 37.9% 0044787 00447871 1/1   -L RNA-binding motif                    
 112::171  8.5e-09 37.3% 0047871 00478711 1/1   -L RNA-binding motif                    
 182::278  8.3e-05 28.8% 0039976 00399761 1/1   ouridine synthase                       
  95::161  0.00011 31.3% 0047115 00471151 1/1   -L RNA-binding motif                    
  79::162  0.00046 30.5% 0039540 00395401 1/1   -L RNA-binding motif                    
   1::426


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVAGGGGGDDARPLRQPQRGLGGDRNASLGAEKLIADGDENRRERQRRGQARDHHHPPHPRKQRGLFGGR
00424431   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FGQGGFGHAMLGFGSVFLEGSIVNDSSGHLLEVVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVA
00424431   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00357941   1/1  ------------------------------------------kklseyglqlrekqklrffYgltekqll
00518111   1/1  ----------------------------------------------------------------------
00376161   1/1  ------------------------------------------krylgPklklirrlgrellltgkyglln
00364961   1/1  -------------------------------------ellemRLDkvlyragfaktrslArqlvehGhvl
00447871   1/1  ----------------------------------------gmRLdkflarlgla.srseakklieagrVl
00478711   1/1  -----------------------------------------lRLdkflaelgll.sRseakklikagrVt
00399761   1/1  ----------------------------------------------------------------------
00471151   1/1  ------------------------dglPdvllellllleegirldklLvraglakSrsearrlikqggvr
00395401   1/1  --------alfhgglaelqaeelfellddlpevel..llleirLdklLvraglakSrreArrliqagaVl


                         +         -         -         -         -         *         -:210
query           IRGAPVRDPAYHAASGETITIDVPPPVAPEPAGEAIALEIVHEDDDIIVIDKPRGLVVHPAAGHETGTLV
00424431   1/1  ----------------------------eellvevlgldilyededllvlnKPagllvhpgdgllrgtll
00501021   1/1  -------------------------------------ldilyedddllvlnKPagllvhpgdgllrgtll
00501991   1/1  ------------------------------------------edddllvlnKPagllvhpgdgl.rgtll
00436061   1/1  -----------------------------------------yeddgllvldKPagltshpvvgklrrll.
00478721   1/1  --------------------------------------------ddllvlnKPagllvhpgdglgr.tll
00525421   1/1  --dllllklllkvlgkllvlvllltplglgvlpedrplkvlyedg.llvldKPagltshdvvgkvkrtl.
00357941   1/1  nyfkealklkgvtglnllqllerRLDkvlarlglaksrrqArqlilhGhVlVngkvvdkpsykVkpgdvi
00518111   1/1  ---------------glvlelglkvdpeldvlvlgrplklllldg.vllldKPagvtShdvvakvr.rll
00376161   1/1  kkellkreyppgqhgqlarkklslyllqlrekqklrffygllerqllryfklarklkgvtglnllqlLEr
00364961   1/1  vnGkrvk.Psylvkvgdvitvregskellvvvlallelrrgapealllyeekleglvlrlpereelplpi
00447871   1/1  vngkvvtkpsykvkpgdvievdgkllepl-----------------------------------------
00478711   1/1  vngkvvtkpslkvkpgdvitvdgellellel---------------------------------------
00399761   1/1  -----------------------------------------yllngillldKPagltshdvvallk....
00471151   1/1  vngevvtdpglkvllgdvivl-------------------------------------------------
00395401   1/1  vngekvtdpgykvdpgdlievd------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
00424431   1/1  dlllallgd....lggllrlypvhRLDkdTsGllllakdgeaarrlseqfpkr....eveKtYlalvegv
00501021   1/1  dlllall........glprlypvhRLDrdTsGllllakdgeaarrlselfper....kveKtYlAlvagv
00501991   1/1  dlllallg.........lrlylvhRLDkdTsGllllakdgelarrl..lfpkrk....veKtYlalvlgv
00436061   1/1  ...............gvkkvghvgrLDpdtsGvLvlalgg.atkllsyllk.......vdKtYlalvllg
00478721   1/1  dlllall.........lprlypvhRLDrdTsGllllakdgeaarrl..lfpkrk....veKtYlalvagv
00525421   1/1  ...............glkkaghvGtLDplasGvLvvalge.atklvkyl.......ldvdKeYvalvrlg
00357941   1/1  tvd-------------------------------------------------------------------
00518111   1/1  dll...............kvghvGtLDplatGvLllalgg.atkllspll.......dvdKtYlatvrlv
00376161   1/1  RLd-------------------------------------------------------------------
00364961   1/1  ne--------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ............rllgvkkvghaGtLDplatGvLllalge.atkllsyll.......dadKtYvatvl--
00471151   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
00424431   1/1  pped.glidlplgvllddglklavledgkpavtlfrvlerlg......glslveltlltGRtHQiRvhla
00501021   1/1  peeeegtilaplvrlpdgrlklavvvleggkpavtryrvlerlg......glslveltlltGRtHQiRvh
00501991   1/1  lteellglldlg............vlldgkpaltlyavlerl.gl......slleltlltGrthqiRvhl
00436061   1/1  latdtgdidgeiletlgrdpltrekiekllasflgeilqvPPlysavkvnGkrlYelaregveveleark
00478721   1/1  lteellgtldag............vvldgkpavtlfavlerl.g......lslleltlltGrthqiRvhl
00525421   1/1  vatdtgdlegeileftgeilqvpPlrsavkrdgrrayelarkglevelp.....llllevtcskG..tyi
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  gliteealekllagftgeilqvPpmysavkvdarpvtiyelellefdlpl......vllevtcskgt..y
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           HIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA
00424431   1/1  alghpilgDplYggllllllllll.llrlkrlgigrlaLhAyrlsfphpltgelreltaplpedllelle
00501021   1/1  laalghpilgdprygigellldlllaggllk......rlaLhAlrLsflhpltgellefeaplpedflal
00501991   1/1  aalghpilgdkrygignlllgldlhagelrfltplellll.-----------------------------
00436061   1/1  vaitslelle....fdgplglslvelrvetgrgtyiRvlaadlgh-------------------------
00478721   1/1  aalghpvlgdkryg..............ignllllgrlalgawrllflhellll----------------
00525421   1/1  RslvhdlglpLgcgAhvseLrRtrvgpftld..............daltledlallallllfelple---
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  iRslaadlGlaLgvgahvleLrRtrigpftlddaltlgdlelllllekllklllpldlllld--------
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ALTATE----------------------------------------------------------------
00424431   1/1  llg-------------------------------------------------------------------
00501021   1/1  lellgl----------------------------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------