[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE37710.1


[Show Plain Result]

## Summary of Sequence Search
   1::137
   2::137  1.4e-49 53.7% 0052864 00528641 1/1   omain-like                              
   1::136  1.6e-49 54.1% 0051555 00515551 1/1   omain-like                              
   1::136  5.8e-47 52.2% 0051817 00518171 1/1   omain-like                              
   2::135  1.8e-45 52.3% 0052524 00525241 1/1   omain-like                              
   2::135  1.1e-44 53.0% 0052824 00528241 1/1   omain-like                              
   1::136  1.9e-32 45.3% 0050660 00506601 1/1   omain-like                              
   1::137


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEIIGIAEIIREA
00528641   1/1  -aYWLlksePdvysiddlvaegeqltlwdgvrnyqarnflrdmkvGDlvlfYhsncekgivGiaevvkea
00515551   1/1  mayWLlksePdvysiddlvalgeqttlwdGvrnyqarnflremkvGDlvlfYhsnkkpgivGiaevvsea
00518171   1/1  slskmayWLlksePdaysiddll..kegttlWdGvrnyqarnflrdmkvGDlvlfYhsnakepgivGiae
00525241   1/1  -aYWLlksePdeysiddllkeg..ttlWdgvrnyqarnflrdmkvGDlvlfYhsnckepgivGiaevvse
00528241   1/1  -aYWLlksePdvysiddlv..kegttlWdGvrnyqarnflrdmkvGdlvlfYhsnlkepgivGiaevvse
00506601   1/1  mnYWLlksep...............dnwdgvrnygargvpegkknllkrmkpgDlvlfYhsktgepggkl


                         -         -         *         -         -         -         -:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGL---
00528641   1/1  ypdptafdprwllvdvkfveklkkpvtlselkalpeledllllrgsrlsvlpvteeewelilkllgl---
00515551   1/1  ypdptafddprwllvdvkfveklkkpvtlselkalpeledllllkgsrlsvlpvteeewelilell----
00518171   1/1  vvseaypdptafdpespyydpkskpekprwllvdvkfvrklkkpvtlkelkalpelkdllllrgsr----
00525241   1/1  aypdptqfdpeskyydpkskpekprwvlvdvkfvkklkrpvtlselkalpeledllllkrgsrls-----
00528241   1/1  aypdptafdpeskyydpkskpekprwvlvdvkfvkllkkpvtlaelkalpalkdllllrkgsrls-----
00506601   1/1  llqsivGigeVvseaypdptpifdpesladdprpyrvdvkaviilevpikpllpsLefiknkpklg----