[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE37723.1


[Show Plain Result]

## Summary of Sequence Search
   1::194
  55::193  1.1e-40 47.8% 0041721 00417211 1/1   domain                                  
  28::195  6.9e-39 41.8% 0041628 00416281 1/1   domain                                  
  60::195  1.8e-34 47.7% 0041720 00417201 1/1   domain                                  
   1::194


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKRIAYLSAAALSALALTATAMAPANAEDKKMMKSEMSGEKTVMVGGAPMYPSKNIVENAVNSKDHSTL
00417211   1/1  ------------------------------------------------------ktilelleslgdlstf
00416281   1/1  ---------------------------cakllpadvectngvihvidgvlcppsgnllelLeklgdlstf
00417201   1/1  -----------------------------------------------------------ilasdpdlstf


                         -         -         *         -         -         -         -:140
query           VAAVKAAGLVKTLEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDG
00417211   1/1  vdlleaaglvdtLsgtdgpfTvFaPtneAfeklpagllsallkdelllnkellkelLkyHivpgdvllll
00416281   1/1  lsllkslpllaaglldtlng.gpfTvFaPtneAfaklppdtlnalls..nkellknllkyHvvpgrltss
00417201   1/1  vslleaaglldtlnsdgpfTvfaPtneAfaklpagtln.....lnkellrellkyHvvpgvllssdlkng


                         +         -         -         -         -         *         -:210
query           KKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPS----------------
00417211   1/1  edllngssallltlllttlagsklrvnvygggvtiti.lvnnakvikadilat-----------------
00416281   1/1  dlkng..lktlagdklrvsvsggsvtv.....ngarvieadilatngvihvidkv---------------
00417201   1/1  savlttlletlngkklrvnvtlltdgggsvtvngggvlakvvkadilasngvihv---------------