[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE37731.1


[Show Plain Result]

## Summary of Sequence Search
   1::344
 129::319  6.2e-81 51.3% 0046003 00460031 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 129::319  1.4e-80 51.3% 0040869 00408691 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 129::319  7.6e-72 56.6% 0053020 00530201 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::319  1.9e-70 53.2% 0052979 00529791 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::319  1.5e-69 49.5% 0041597 00415971 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 129::327  3.9e-67 59.3% 0035953 00359531 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::156  2.4e-50 50.0% 0052818 00528181 1/1   )-binding Rossmann-fold domains         
   3::158    1e-48 48.7% 0052978 00529781 1/1   )-binding Rossmann-fold domains         
 130::324  4.7e-48 43.2% 0045517 00455171 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::323    8e-46 43.3% 0035946 00359461 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 129::327  5.2e-45 42.8% 0052355 00523551 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::323  1.5e-44 39.8% 0036580 00365801 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::144  1.3e-43 46.5% 0040868 00408681 1/1   )-binding Rossmann-fold domains         
   2::142  1.5e-43 46.1% 0041596 00415961 1/1   )-binding Rossmann-fold domains         
   2::142  1.4e-41 51.8% 0035680 00356801 1/1   )-binding Rossmann-fold domains         
 130::324    1e-40 40.4% 0038023 00380231 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::324  1.3e-40 28.0% 0039315 00393151 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::323  2.8e-39 42.8% 0038051 00380511 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::146  1.2e-36 40.8% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   3::162    1e-35 39.5% 0052326 00523261 1/1   )-binding Rossmann-fold domains         
 130::323  1.6e-35 25.9% 0047176 00471761 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 129::323  2.4e-34 26.6% 0041771 00417711 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::315  5.3e-33 31.2% 0050229 00502291 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::315  1.7e-29 23.9% 0052327 00523271 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::161  4.8e-29 30.4% 0051147 00511471 1/1   )-binding Rossmann-fold domains         
 130::314  5.9e-25 23.0% 0051148 00511481 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::324  7.3e-24 25.9% 0051902 00519021 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::169  9.5e-24 29.3% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 130::300  4.9e-23 32.4% 0035390 00353901 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 130::315  9.6e-19 21.0% 0047635 00476351 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::250  9.1e-13 21.5% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   3::160  3.3e-12 30.4% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
   3::127  7.3e-11 23.3% 0045645 00456451 1/1   )-binding Rossmann-fold domains         
   3::151  1.6e-09 25.2% 0038050 00380501 1/1   )-binding Rossmann-fold domains         
   3::124  6.3e-09 22.9% 0050914 00509141 1/1   )-binding Rossmann-fold domains         
   1::153    4e-07 22.6% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
   2::92   2.9e-06 29.7% 0039919 00399191 1/1   )-binding Rossmann-fold domains         
   3::73     9e-06 33.3% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   1::73   3.9e-05 40.0% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::119  7.4e-05 21.9% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
   1::112  0.00015 24.3% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::118  0.00017 40.7% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   3::168  0.00018 26.4% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::153  0.00023 18.2% 0052183 00521831 1/1   )-binding Rossmann-fold domains         
   1::73   0.00031 38.1% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   1::143  0.00032 28.0% 0052415 00524151 1/1   )-binding Rossmann-fold domains         
   1::40   0.00047 41.0% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   1::344


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
00460031   1/1  ----------------------------------------------------------------------
00408691   1/1  ----------------------------------------------------------------------
00530201   1/1  ----------------------------------------------------------------------
00529791   1/1  ----------------------------------------------------------------------
00415971   1/1  ----------------------------------------------------------------------
00359531   1/1  ----------------------------------------------------------------------
00528181   1/1  -klkvavvGAtGavGeelvelLeehpdfevtallllasersaGkklsflgpslvglkdleveeldpaeev
00529781   1/1  --glkvaivGatGlvGqellelLeehpfpeltllllasrssagkylefvgkdlkvleldefdfsdvdivf
00455171   1/1  ----------------------------------------------------------------------
00359461   1/1  ----------------------------------------------------------------------
00523551   1/1  ----------------------------------------------------------------------
00365801   1/1  ----------------------------------------------------------------------
00408681   1/1  --mkvaivGatGmvGsvllelLleergfevvalvrlsssrsagkalvfkgvellvvdlldlealkgvDvv
00415961   1/1  -klkvgivGatGmvGsvllnllleendFevieivflassrsagkkllflgkellvlldaldidalsgvDi
00356801   1/1  -mkkvaivGAtGmvGsvllkllleerdfpvillvllassrsagkavsfkgvtlvvgdlldlealkgvdiv
00380231   1/1  ----------------------------------------------------------------------
00393151   1/1  ----------------------------------------------------------------------
00380511   1/1  ----------------------------------------------------------------------
00530191   1/1  kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasagkgvevvlgdltdldllaaalagvdvvfl
00523261   1/1  --kalkkikvailGAtGyvGqellrlLlnh..pevelvalassssagkklsdllplllglkdlvvlelda
00471761   1/1  ----------------------------------------------------------------------
00417711   1/1  ----------------------------------------------------------------------
00502291   1/1  ----------------------------------------------------------------------
00523271   1/1  ----------------------------------------------------------------------
00511471   1/1  mpikvaiiGasGytGgellrlll..nhpdlellllasresagkkleevypdlrglldlvleladleelke
00511481   1/1  ----------------------------------------------------------------------
00519021   1/1  ----------------------------------------------------------------------
00502281   1/1  -mmkvlitGAtGfiGselvrlLle..hgdhevtaldrrtsagkllnepgvevvegdltdpddlekalkgv
00353901   1/1  ----------------------------------------------------------------------
00476351   1/1  ----------------------------------------------------------------------
00519911   1/1  lllllllimmmlkgkkvlvtGAtGgiGralvkeLlerga.vskVtalvRrpekleelaaegvevvvgDlt
00422071   1/1  --mkVgivGAtGrvGrllvrllla..hpgvevvavvsraeaaellkllgadvvvdatppdvlaelaeall
00456451   1/1  --mienlllllelllelellkslkkpmkvlvtGAaGfiGshlallLasgglagldqvvelvlldiveslg
00380501   1/1  --kikvgiiGa.GriGrellrallas..pdvelvavadrddaaalaaalkydsthgkfdgtvkaedgklv
00509141   1/1  --nkkkrvaiiGa.GriGsalaralleap..gfevvgvfdvdpekvgraie.glpvlgvddleelleggv
00484541   1/1  mmkklkvaiiGa.GniGlalarallalag..gaevvavadrdpekaglalakelgatttvnavddleell
00399191   1/1  -pikvallGltGtVGqgvvklLeenpelfevvalragrnvalkvelvleykdaavavrdedkprelkdll
00481861   1/1  --kkvlvtGAsGgiGsalalllaarga...evvlldrspeklegvaldlsdlgvevvvadltdp..esla
00527221   1/1  llllkillslkgkkvlvtGAtGgiGralvkellarga.vskvialvRrpekleelaaegvevvvgDlt.d
00475161   1/1  hgkkvgiiGl.GniGkavakllk..gfgmevlaydrrpke..........gavyvsldella.esDvvvl
00354771   1/1  MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsdgalavlldltd
00430411   1/1  MsgkkvlvtGAtGfiGshlaraLleaG...hevvalvRspekaalalalelleelaapgvevvegDlt.d
00387841   1/1  --kkvlvtGAsGgiGsalalllake..gaevvlvdrdeekalealagelldlgggalvlvadvtdleave
00521831   1/1  m..KilviGaaGyvGsslalllakkgllgdelvlvDieekleglaldlsdiaefllldlvittdlyealk
00464721   1/1  MgktvlvtGatGfiGsalaraLlar..GaveVvaldrspe.....Dltdpeslaaalagv...rvdvvih
00524151   1/1  MkkikvgiiGf.GriGrlvarallenk..dielvavndrnpd...ngkkigvlaeddpeel.lkgvDvvv
00516961   1/1  kgkrvlvtGAtGfiGshlvrrLlaeghvs.evvalvrrps------------------------------


                         -         -         *         -         -         -         -:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
00460031   1/1  ----------------------------------------------------------NCttilmvvaLk
00408691   1/1  ----------------------------------------------------------NCttilllvalk
00530201   1/1  ----------------------------------------------------------ncttiqlvlaLk
00529791   1/1  -----------------------------------------------------------CttillllaLk
00415971   1/1  ---------------------------------------------------------PnCttillvvalk
00359531   1/1  ----------------------------------------------------------nCstiqlvvaLk
00528181   1/1  fsgvdlvffaagaevsrelapralkagavvidnssafrlddeelyekyygvslelpellpdvPlvvPevn
00529781   1/1  falgsevarelapkaaeaGvvvidnssafrldpdvPlvvpevnpehldll..gfivanPnctttalalal
00455171   1/1  -----------------------------------------------------------Cttillvpalk
00359461   1/1  -----------------------------------------------------------Cstiqlvvalk
00523551   1/1  ----------------------------------------------------------sCnTtglaralk
00365801   1/1  -----------------------------------------------------------Cstiilvpalk
00408681   1/1  ifaaggdvtlklapalaeagvkrvvidsssalrmdddvplvvpevnreaikdalakgggiianpncttil
00415961   1/1  iilclGgdvskevapklaeagwkgvvidaasalrmeddvplvlpevnlevikdllarglkiianpnCtts
00356801   1/1  ifaaggdvslelapalreagvrlvvidnssalrmdpdvplvvpevnrevikdalalgvkiianPncttil
00380231   1/1  -----------------------------------------------------------Cstaqlvvalk
00393151   1/1  -----------------------------------------------------------CTTnclapllk
00380511   1/1  -----------------------------------------------------------Cttiqlvvalk
00530191   1/1  aagagatlalaeaaaaagvkvidlssafrad.dvpyglpkvnaealllasglniiarpgcyttplvlala
00523261   1/1  ealsdvDvvFlalphgvalelvk.llkaglkviDlsadfRlddavpyvvpyvnphhldlllkkavyglpe
00471761   1/1  -----------------------------------------------------------CTTnclapvlk
00417711   1/1  ----------------------------------------------------------sCTTnclapllk
00502291   1/1  -----------------------------------------------------------Cyptaallala
00523271   1/1  -----------------------------------------------------------Cyptaailala
00511471   1/1  aDivflalphgasaelvpllle.glkviDlsgdyrledfelyealygveklvpeldgewvyGlPElnree
00511481   1/1  -----------------------------------------------------------Cyataailala
00519021   1/1  -----------------------------------------------------------CTTnclapvlk
00502281   1/1  Dvvihaagtsrvdeslkdal..gtnvigtssalrllnlleaakeagvkrfvhvstagvygllegvpelle
00353901   1/1  -----------------------------------------------------------CtTngLapllk
00476351   1/1  -----------------------------------------------------------CTTnclapvlk
00519911   1/1  dpeslaaalkgvdvvinaagitrvgedleefldvnvdgtlnlldaakkagvkrfvlvSslgalgp.....
00422071   1/1  kagvdaVilsaGfrlsdlllvellydaaggvkvv...............................iaana
00456451   1/1  klegvaldlsdaafpllgdvtvgtdlyeafkgadvvvhlAgvprkpgmdrldllktn-------------
00380501   1/1  vngkligvlvvtdpaelllgdegvDvvvdatppgahaenalaaleaGvkhvivekPla..advvellvgl
00509141   1/1  dvvilavPaeaaqevadelleagvkvillpplarllvgaavvvrevdledllgr----------------
00484541   1/1  adpgvDvvieatpagahaevalaaleagkhvvvekptaltveeavvpl....velvelaeekgvvlgvgf
00399191   1/1  veegveledllltddalelved------------------------------------------------
00481861   1/1  eal-------------------------------------------------------------------
00527221   1/1  pes-------------------------------------------------------------------
00475161   1/1  capleaineealaalkkgailintsrgalvdeeallelleagkiagagl---------------------
00354771   1/1  tddlaealk.....gadvvvhlagvprkpgedrddllavnvl----------------------------
00430411   1/1  peslaea.lkgvdvVihlag...........................d----------------------
00387841   1/1  dlvealggadvvvnnagvp.......................rkpgeerldllevnvlg...........
00521831   1/1  dadiviitagvprkpgmsrldlle..............inakivkdiakaikkyspkaivlvvtnPvdtl
00464721   1/1  lAg-------------------------------------------------------------------
00524151   1/1  ectggfdtakelalaalkagkkVivsaPlk....daptivlgvnhekldkelkivieaslsnpsftanvl
00516961   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
00460031   1/1  pLheafglervvvsTyqAvSGaGakgveelleqlgallngveseladpasaildidrkvlellrleelel
00408691   1/1  pLhdafgiervlvsTyqAvsGaGakgveeLlsqlgallngvelelddllldildidlrvaraaalsiipt
00530201   1/1  pLhdafgiervvvstyqavSgaGaegvdeLagqtaellngkplepevfprplafnviPlidvflengytk
00529791   1/1  pLlkafliervvvstyqavSGaGakgveellsqtaellngldvkvhrllreleleldvfpvplafNviPl
00415971   1/1  pLhdafgiervlvsTyqAvsGaGakgveelleqlgallngvelelddlasaildidqlvldllhsdllra
00359531   1/1  PlhdafgikrvvvstyqavsGag.......................kfpgpiafnllpniipfidg....
00528181   1/1  pehl...kkggivanP------------------------------------------------------
00529781   1/1  apLlelfgieevlvttlq----------------------------------------------------
00455171   1/1  plhdafglkrvlvttyqavsgaGk............tldglsgklgvfgrgiafnviPhi.....tgaak
00359461   1/1  plldafglervlvstyqavsgaGk.............lvdgpskllvkgrgiafniiPaid.........
00523551   1/1  pLhdafgiervllttrqa.........................dpkrfgrgianniiPsitgashhgg..
00365801   1/1  plhdkfglkevlvttyqavsgagk............tldglsgkllvygrgiaqnviPait.....gaak
00408681   1/1  llla------------------------------------------------------------------
00415961   1/1  lm--------------------------------------------------------------------
00356801   1/1  ml--------------------------------------------------------------------
00380231   1/1  plhdafglkevlvttyqavsgagk............tldglsgkllvfgrgiaqniiPait.....gaak
00393151   1/1  vlhdnfgieeglvttvhavtgsqk............tldgphgkdlrrgraaalniiPt.....stgaak
00380511   1/1  plheefgleevlvttyqavsgagk.............lldglskllvfgrpiaqnviPaid.........
00530191   1/1  plleag----------------------------------------------------------------
00523261   1/1  lnrekikkaklvanPGCyatal------------------------------------------------
00471761   1/1  vLhdafgiekglmttvhaytgdq.............llldgphkdlrrgraaalniiPtst.....gaak
00417711   1/1  vLhdafgieeglmttvhavtgdqk.............lldgphkdlrrgraaalniiPtst.........
00502291   1/1  PLvkaglldldrivvdavsGvSGAGkkaieell............faevlenliaYgllghrhlp.....
00523271   1/1  PlvkaglldldriivdavsGvSGAGrklieellf............sevlenliaYgllgh.........
00511471   1/1  iknaklianPgcyatkGaill-------------------------------------------------
00511481   1/1  PllkaglldldriivdavsGvSGAGrklieel.....................lfaevlenlraYgl.lg
00519021   1/1  vlhdafgieeglmttvhaytgdqk.lldgphgkakdlrrg.........raaalniiPtst.....gaak
00502281   1/1  dallilnpnlygvskllaerpl.......-----------------------------------------
00353901   1/1  vlndkfgieevlvttvrratdpqkv....................kkgpinaivpnpitipshhg.....
00476351   1/1  vlddafgieeglmttvhaytndqklldgphkdlrrgra.............aalniipt.....stgaak
00519911   1/1  ......................................................................
00422071   1/1  scgvnllvplaklladafgi--------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00380501   1/1  nreadkslgvv-----------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00484541   1/1  gvrflppvvkale---------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00387841   1/1  .....tknlaealkka....gpgrivvv------------------------------------------
00521831   1/1  tlialklsgklgl---------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00524151   1/1  val-------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
00460031   1/1  dvfpvplafnviPlidvfldngytkEElklvnEtrKilglddelkvsatcvRvPvlrghseavtvelekd
00408691   1/1  stfaaplafnviPlidvfldngytkeelkmvaEtrKilglldpdlkvsatcvRvPvlrghsealtvelek
00530201   1/1  eElklvaetrkilgdldlkvsatcvrvPvfrghsesvtvelekdvdveevrelladapgvvvlddp..ll
00529791   1/1  idvfldngytkeElklvnEtrkilgdpdlkvsatcvrvPvlrghseavyvelekdvsveevrellaeapg
00415971   1/1  rvfpvpiafnliPlidgllkdngytkEelkmvaEtrKilglpdldlkvdatcvRvPvlrghsealtvelk
00359531   1/1  .......etkkilgvldlkvsatavrVPvllgHsesvlvelekkvsveeilevlkkapgvvllddlelpl
00528181   1/1  ----------------------------------------------------------------------
00529781   1/1  ----------------------------------------------------------------------
00455171   1/1  evgkvlpel......nlkvtgtavrvPvlnghvvdltvelekpakydeikevlkkasgvplkd.......
00359461   1/1  ...kaakevgkilpelnlkvtgtavrVPvlnvhvvdltvelekpasveeikevlkqasevvlkgilg...
00523551   1/1  ..........kvlpvldlklttmAvrVPttlvhvvdltvelekpataeevlealknapgillidededlt
00365801   1/1  evgki......lpelngkltgtavrVPvlngsvvdltvelekpasydeikealkkasggplkg.......
00408681   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00356801   1/1  ----------------------------------------------------------------------
00380231   1/1  evg......kvlpelnlkltgtavrVPvlnvhvvdltvelekpasyeeikkalkqas......ggplkdi
00393151   1/1  avgkvipelngklt......gtavrVPtpnvsvvdltvelekpvtveeikealkeasegplk......gi
00380511   1/1  ...kaakevgkilpelnlkltgtavrVPvlnvhvvdltvelekpakveeikevlkqasevplkgil....
00530191   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------
00471761   1/1  avgkvlpelkg......kltgtavrVPtpnvslvdltvelekevtveevnealkeasegl.........l
00417711   1/1  ...gaakavgkvlpelngkltgtavrVPtpnvsvvdltvelekeasveeinealkeasegplkgil....
00502291   1/1  .....eieqelgkilgldvkvtftphlvpvvrGilatvyvel..gvtaeelrelleefYagepfvrvldl
00523271   1/1  .rhlpEieqelgllagldvkvlftPhlvpvvrGilatvylelkggvsaeellelleeayagepfvrvlpl
00511471   1/1  ----------------------------------------------------------------------
00511481   1/1  hrhlpEieqelgklagldvkvsftPhlvpvlrGilatvyvelkkgvsaeelrelleefYagepfvrvlpd
00519021   1/1  avgkvlpelng......kltglavrVPtpnvslvdltvelekevsveeinealkease.........gpl
00502281   1/1  ----------------------------------------------------------------------
00353901   1/1  .......kdvkkvlpdlkvtatavrVPvtlvhveslnvelekevsaeevkealkeapgivliddeeglts
00476351   1/1  avgkvlPelkg......kltglavrVPtpnvsvvdltvelekevtveevnaalkeasegplkgilgyted
00519911   1/1  .........................spspyaasKaaaeal------------------------------
00422071   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00380501   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00524151   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA------
00460031   1/1  vsveevrellanapglvkvvllddpasllyptpldvsgk-------------------------------
00408691   1/1  dvsleeirellkeapgvvlvddllvseellyptpldatg-------------------------------
00530201   1/1  pptpldavgkdevlvgrirkdlsvpnglnlwvvaDnlrk-------------------------------
00529791   1/1  vvlvddldrglyptpldvtgsdavlvGriRkdlllpngl-------------------------------
00415971   1/1  kdvsveeirellkeapglvlvvllddpeeplvptplnat-------------------------------
00359531   1/1  ypkpllavged...vgrirpdldrdagldeglwvvadnlrkgaAlna-----------------------
00528181   1/1  ----------------------------------------------------------------------
00529781   1/1  ----------------------------------------------------------------------
00455171   1/1  ...ilgytedevvsgrirsdslssifdalalivlndnlvklaal--------------------------
00359461   1/1  ......yteddvvsvgrirddlssifdaglvilsdnlvkgaal---------------------------
00523551   1/1  stael...gefdvdvgrirndlvelvvwgdslwvvgdnlrklaalna-----------------------
00365801   1/1  ...ilgytedevvsgdfrsdsyssifdalalialndnlvklaa---------------------------
00408681   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00356801   1/1  ----------------------------------------------------------------------
00380231   1/1  lgytedpvvssdfvgrirs..sifdalalialsdnlvKlaawnd--------------------------
00393151   1/1  lgytedplvssdfvgrprssi..fdalativlgdnlvklaawyd--------------------------
00380511   1/1  ......gygedevvvgdirsdslssifdalalivlgdnlvkga---------------------------
00530191   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------
00471761   1/1  kgilgyteeplvsvdfigdphssifdalativlgdnlvkllaw---------------------------
00417711   1/1  .....gyteedlvsvdfigddlssifdagltivldnlvklaaw---------------------------
00502291   1/1  geypepkavvgtnfvdigvirdd..rtgrlvlvsv-----------------------------------
00523271   1/1  ge...lpetkavvgsnfvdigvfvdd..rggrlvv-----------------------------------
00511471   1/1  ----------------------------------------------------------------------
00511481   1/1  gelpelkavvgtnfvdlgvavdd..rggrlvvvs------------------------------------
00519021   1/1  kgilgyteeplvsvdfigddlssifdalativlgdnlvkllawy--------------------------
00502281   1/1  ----------------------------------------------------------------------
00353901   1/1  taelielard...lgrirnd--------------------------------------------------
00476351   1/1  plvssdfvgdphssifdalativlgdnlvkllaWy-----------------------------------
00519911   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00380501   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00524151   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------