[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38048.1


[Show Plain Result]

## Summary of Sequence Search
   1::456
  24::455  2.4e-73 30.4% 0044108 00441081 1/1   mine synthetase/guanido kinase          
  22::455  7.8e-73 27.4% 0043170 00431701 1/1   mine synthetase/guanido kinase          
   1::456


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARDQIDMTPLNSRDELVGWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGALLEGMQLLLG
00441081   1/1  -----------------------kfksseeltlGvElElllvdldgldlvlaad................
00431701   1/1  ---------------------lsdfkdsdeltlGiElElllvdpdg........................


                         -         -         *         -         -         -         -:140
query           WEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAHLAQVREVATPLGIGFLGLGM
00441081   1/1  .......ellaalggallggaitpElgesqlElitpvlesldevlaellalrrvlrellaelglgllplg
00431701   1/1  ldlvlaadellellgdlllgglitpElsesqlElatpvlesldelleelralrrvlrevaaelgllllpl


                         +         -         -         -         -         *         -:210
query           TPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATAL
00441081   1/1  thPfldweeqiitpkprYrellerlryva.....reqvicgvHvnlgvpseeeavallralrrllPlllA
00431701   1/1  gthPladwseqrlspkprYktlieylgylg.....rrmlicglHvhlgvssedeavallnllrrllPlll


                         -         -         -         +         -         -         -:280
query           FANSPFTEGKPNGFLSFRSEIWRDTDNARSGMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGS
00441081   1/1  LsAsSPfleGkdtgyaslRllvfgalpda...glpplfdsldeyesyvellldtgviqieke........
00431701   1/1  ALsAsSPfldGkdtgyaslRllvfgalpdag...lpplfdswaeyeeyvelllntgviq...........


                         -         *         -         -         -         -         +:350
query           SFRDFFDGKNEKLPGERPTLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSL
00441081   1/1  ..............................lwwdvRpkpglgtlElRvlDvqptleellalaallrllvl
00431701   1/1  ...........................ilselwwdvRpkpglgtvElRvlDvqptlaellalaallralv


                         -         -         -         -         *         -         -:420
query           DAAWEIVKGWDASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLAA
00441081   1/1  lllledglllpllpvslldenlwraarygldaelilaadgeelslrelleellellapvaeelg......
00431701   1/1  lyl..lleaglllllldallleenlwrAaryGldaelidladgreillrelleellellapvaeelgele


                         -         -         +         -         -         -         -:490
query           LDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAF----------------------------------
00441081   1/1  ..elellapllelilergtlAerllelleeggdlk-----------------------------------
00431701   1/1  ........lleplaerilergngAerqlellaegg-----------------------------------