[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38106.1


[Show Plain Result]

## Summary of Sequence Search
   1::494
 330::487  4.9e-51 46.2% 0050343 00503431 1/1   otide cyclase                           
   1::494


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKEIGRRRRMSARLLIASSVITVLGFSAVCGSIMLDMRGNAQELARQTQENLASTISADINRNIEAYDL
00503431   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SLRSVVSNLALPQLAHVDETLRRLILFDHASIARHFGSIQVFDAQGNLTIDSATLTPEKLNRGDEPFVSA
00503431   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HRDDPTVGLYISRPMQHRGTFAIVLSRRISGTDGRFLGVVAGSIRFSYFKQVFSRLRLEPDDTIGVVARD
00503431   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GTLVMRTPFRPDVIGTNVMGAPGVRQVFSQRRGWYSGEGIIDQIPRMMVWADGTRPLVVIVGKSWSDVFR
00503431   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MWRHEAIRISLILLGLAIIVAGFTVFFIREIDRRAEAERRLEELATTDSLTGLINRRKFDTLIEREWRRA
00503431   1/1  -------------------------------------------------LTglpnrraflerlerllara


                         -         -         -         -         *         -         -:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
00503431   1/1  rrsglplalllldldnfklindtyGhaagDevLkevaerlksll.regdlvaRlggdeFavllpdtdlee


                         -         -         +         -         -         -         -:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEAADKALYAAKDLGRNCCVVAASRHDL
00503431   1/1  alalaerlrealeelllpflldglellvtvsiGvaly.pddgedleellkrAdlalyraKragrnrv---


                         *         -         -         -         -         +         -:560
query           TLAA------------------------------------------------------------------
00503431   1/1  ----------------------------------------------------------------------