[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38119.1


[Show Plain Result]

## Summary of Sequence Search
   1::496
 124::386  1.1e-48 31.7% 0048645 00486451 1/1   tin-like                                
  75::338  5.2e-11 22.8% 0049510 00495101 1/1   tin-like                                
   1::496


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTANSTTRDPTGSHAMNIMNVDYSTKIPNNVDLASDRQVLKALEGWHPGYIDWWNDMGPEGFQQSLVYLR
00486451   1/1  ----------------------------------------------------------------------
00495101   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEP
00486451   1/1  -----------------------------------------------------Yrdalirlllrladsel
00495101   1/1  ----klyleadydilarnldwepsyddgrelypkeytaqwgikmsdWdafrDPfqltyrtYvkmqaekee


                         +         -         -         -         -         *         -:210
query           ASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLG
00486451   1/1  vlaqrlsewigrAPsle..edlalanivlDelgharllyrlleelfgvg.redalallr....derkfrn
00495101   1/1  rvya......lidaler..lgaadrldpryrealkrllsalahaEyaaalgfaalarlapgl.elrnaal


                         -         -         -         +         -         -         -:280
query           AFNEATPDWLSFFMFTYFTDRDGKMQLHSLAQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEA
00486451   1/1  lllfelPngdwadtvvrqflvdraallllealaessyeplariaakilkEeayHlrhgeewllrlgdgte
00495101   1/1  aqalDelRhaqaqlylsrlgllldg.gfdealkalwlndpawqglR..slfedllvtgdwleavvalnlv


                         -         *         -         -         -         -         +:350
query           MRDAGISDPTDIAKVRALGVIDLPTIQKKLNLHYTLSLDLFGSEVSTNAANAFNAGIKGRYHETQIDDDH
00486451   1/1  esrer......................lqdalnrlwpytlelfg..pddseealaaagikvdndelr...
00495101   1/1  feaaltnlllvallsvaaangdpatatvflsiqsDEsrhlanGyellkvlae...pa.------------


                         -         -         -         -         *         -         -:420
query           RLANDTYPVLKFVNGEIKRVDEPALTALNMRLRDDYSQDCVKGLLRWNKVITTAGYDFQLALPHVAFHRA
00486451   1/1  .qefldevvpvleelglevPdvdlllnggrdGlhte----------------------------------
00495101   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IGEFKGVHATPEGLLIDGATWARRKDDWLPSTDDGDFIASLMQPVSDPGAYAPWIAAPKVGIDNKPGDFE
00486451   1/1  ----------------------------------------------------------------------
00495101   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           YVKIET----------------------------------------------------------------
00486451   1/1  ----------------------------------------------------------------------
00495101   1/1  ----------------------------------------------------------------------