[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38168.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
   1::242  1.8e-98 54.8% 0036966 00369661 1/1   ne nucleotide alpha hydrolases-like     
   1::244  8.2e-91 52.5% 0046546 00465461 1/1   ne nucleotide alpha hydrolases-like     
   1::244  2.8e-86 51.6% 0048520 00485201 1/1   ne nucleotide alpha hydrolases-like     
   1::213  8.8e-39 34.4% 0048521 00485211 1/1   ne nucleotide alpha hydrolases-like     
   2::213  6.3e-24 29.8% 0046540 00465401 1/1   ne nucleotide alpha hydrolases-like     
  45::169  3.7e-06 27.8% 0036970 00369701 1/1   ne nucleotide alpha hydrolases-like     
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
00369661   1/1  mkilVlvkqvpdtevkvridpvdgtldregvkliinpfdeiAleeAlrlkeklggtevtvvsvGppeaee
00465461   1/1  mkilVcvkqvpdtnvkvrvdpdgvtvdregvklvinpfdlialeeAlrlkekllggevtvvsvGppeaee
00485201   1/1  mkilVcvkqvpdtnvkvrvdpkgvtvdregvkgiinpvdlealeeAlrlkeklggalevtvvsvGppeae
00485211   1/1  mkvlVlaehv.....................ngklnpvslellgaArrlaeklg.gevvavvigsg.aee
00465401   1/1  -svlVlaehvng.....................klnpvtlelltaArel.....ggevtvlvlgpgvaav
00369701   1/1  --------------------------------------------ksvlVlaEhrdgelkpvslellgaAr


                         -         -         *         -         -         -         -:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
00369661   1/1  alrealamGadrailvevsddalagadtlatakaLaavikklgpdlvllGkqaiDgdtgqvgpllAallg
00465461   1/1  alrealamGadrailvsddaledagadplatakaLaaaikklgpdlvllGkqaidgdtgqvgpllAellg
00485201   1/1  ealrealamGadrailveddalagadtlatakaLaaaikklgpdlvllGkqaidgdtgqvgpllAallgl
00485211   1/1  laeealaygadkvllvdddala.ylaeayakalaalikkekpdlvllgatalgkd...laprvAallgag
00465401   1/1  aleealaygadkvlvadddalagylaeayaaalaalik..dpdlvlagatalgkd...laPrvAalldvg
00369701   1/1  kl.ggevtvvviGsgvdelaeelakyaGadkvlvaddpalegylaeayakalaalikklgpdivlagata


                         +         -         -         -         -         *         -:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTADQYGVD
00369661   1/1  lplitlvsklevdggkllvtrelegglevvelklPavvtvdlglnepRypslpnimkakkkplevlslad
00465461   1/1  lplvtdvsklevdggkllvtrelegglevvevslPavvtvrkglneprypslkgimkakkkpievlslad
00485201   1/1  plvtdvtkleidleggkllvtreleggllevvevslPavvtvrpglneprypslkgimkakkkpievlsl
00485211   1/1  lvsdvtelevddgkltvtRpiyggnalatvklpdsrpavlTvrpgafepaeaggsaiveavevplddlrt
00465401   1/1  lisdvtelevdl...tftrpiyggnaiatvkstdrpavvTvrpgafepaaeggsgaveavkveldellse
00369701   1/1  igkd...laPrvAarldvglvsdvtalev-----------------------------------------


                         -         -         -         +         -         -         -:280
query           LAPRLEVLKTVEPSGRKAGVKVKDVAELVSKLKNEAGVI-------------------------------
00369661   1/1  lgldlgsptkvlkvfepekrragiiiegvdel--------------------------------------
00465461   1/1  lgldlgsptkvlkaeipvargrgikvgdvlelae------------------------------------
00485201   1/1  ddlgvdlevvglagspvkllkaevpvsrgrgikv------------------------------------
00485211   1/1  kvl-------------------------------------------------------------------
00465401   1/1  vlg-------------------------------------------------------------------
00369701   1/1  ----------------------------------------------------------------------