[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38181.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   4::215  6.1e-56 39.7% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   1::215  1.6e-54 36.4% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   2::220  1.7e-54 39.4% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::218  8.5e-54 38.2% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   1::215  1.2e-53 38.7% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   1::218  1.2e-53 39.0% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   2::215  3.6e-52 38.8% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::215  1.7e-51 42.0% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   1::218  7.6e-51 37.2% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   1::218  1.4e-50 38.8% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   2::218  2.4e-50 38.9% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   1::211  3.8e-50 39.9% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
  17::219  5.6e-49 38.9% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   1::215  1.9e-48 44.4% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   1::218    4e-48 37.9% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   2::218  4.4e-48 38.7% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   3::218  5.2e-48 39.8% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   2::215    8e-48 38.3% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   1::221  9.7e-48 36.8% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   2::215  2.2e-47 37.2% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::218  4.5e-47 37.9% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   2::218  5.3e-47 38.6% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   1::218  4.9e-46 37.6% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
  14::214  1.4e-45 41.8% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   2::218  2.6e-45 34.3% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  10::219  2.8e-45 41.6% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   1::215  8.3e-45 46.6% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::218  2.4e-44 38.8% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   1::218  1.6e-43 42.8% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::215  3.3e-43 38.8% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::206  8.8e-43 37.2% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   1::218  2.1e-42 42.2% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::215  5.5e-42 40.9% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   1::218  1.5e-41 40.7% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   4::218  1.2e-40 44.5% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   1::215  1.6e-40 40.6% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  17::218  3.9e-39 36.0% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   1::215  1.1e-38 39.9% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  29::184  2.6e-37 40.9% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
   1::215  3.1e-37 43.7% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
   1::213  5.4e-37 39.0% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  18::215  6.9e-37 42.0% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  23::218  1.1e-36 42.4% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  20::215  4.3e-36 38.8% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  26::218  2.2e-35 38.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  11::221  4.5e-35 37.2% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  15::195  1.9e-34 40.8% 0047552 00475521 1/1   arboxykinase-like                       
   1::215  2.2e-34 38.9% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  14::209  6.6e-34 39.4% 0047841 00478411 1/1   arboxykinase-like                       
  17::217  1.1e-32 38.5% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   1::219  1.7e-32 37.6% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  26::219    2e-32 39.6% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  15::215  8.3e-32 38.6% 0053253 00532531 1/1   arboxykinase-like                       
   1::216  7.1e-31 34.2% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  22::169  4.2e-30 39.7% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  26::212  4.2e-30 37.3% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  29::220  1.4e-29 38.3% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
   2::218  1.7e-29 37.3% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  26::173  3.8e-29 40.3% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  27::190  1.6e-28 35.8% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   1::127    4e-27 41.7% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  30::212  7.5e-27 36.4% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  26::215  1.2e-26 35.0% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  11::208  6.4e-26 31.8% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   3::220  1.4e-25 29.7% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  26::210  1.9e-24 39.0% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  20::217    8e-24 31.1% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  14::199    1e-23 31.7% 0047844 00478441 1/1   arboxykinase-like                       
   1::210  1.3e-23 33.1% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  27::187  1.3e-23 36.0% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  27::199  1.6e-23 37.7% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   4::219  2.5e-23 33.5% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  18::214  4.3e-23 28.6% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  32::211  7.2e-23 34.3% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  18::215    2e-22 32.7% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  18::213  2.7e-22 31.9% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  16::219  1.2e-21 30.7% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  28::218  1.3e-21 32.6% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   4::195  5.6e-21 29.8% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  19::191  7.5e-21 34.9% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   2::208  1.4e-20 39.7% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   2::212  1.9e-20 35.4% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  29::202  9.1e-20 30.3% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  23::195  1.8e-19 37.6% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  32::219  9.5e-19 34.2% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   3::214  3.9e-18 27.4% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  16::208  4.4e-18 36.8% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  16::208  7.5e-18 36.8% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  22::204  9.5e-18 25.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  30::212  1.2e-17 31.4% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  18::195  4.9e-17 31.2% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  28::170  4.9e-17 38.8% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   2::208  1.6e-16 31.7% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   5::219  1.7e-16 28.7% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  29::215  1.1e-15 22.2% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  20::217  1.3e-14 24.0% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  19::208  1.5e-14 32.0% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  16::208  6.5e-14 36.8% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  28::219  1.8e-13 32.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  29::215  1.8e-13 26.2% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  15::215  2.9e-13 31.1% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  16::210  1.5e-12 29.1% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  15::198  1.7e-12 37.5% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  16::208  2.6e-12 23.5% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  25::204  1.5e-11 28.4% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  21::208  5.1e-11 34.1% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  29::215  6.6e-11 29.4% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  22::193  1.7e-10 38.9% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
   2::219  2.4e-10 29.0% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  16::209  2.5e-10 31.6% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  21::208  2.6e-10 29.2% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  22::203  3.9e-10 23.8% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  22::204  6.7e-10 26.4% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  22::214    1e-09 25.5% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  15::208  1.6e-09 32.5% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  29::219  8.2e-09 27.9% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   6::195  2.9e-08 24.8% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   2::208  2.1e-07 22.8% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  21::216  2.3e-07 24.3% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  26::219  3.5e-07 27.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  26::165  4.4e-07 27.6% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  10::208  4.7e-07 27.1% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  28::179  4.9e-07 27.9% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  16::215  1.9e-06 25.2% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
   5::211  1.7e-05 24.2% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
  29::221  2.4e-05 25.3% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  24::208    3e-05 23.1% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  32::220  4.1e-05 27.4% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  28::165  4.4e-05 27.2% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  23::209  4.9e-05 20.9% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  27::170  4.9e-05 35.4% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  29::164  5.1e-05 24.2% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  16::87   5.2e-05 34.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  29::218  5.7e-05 25.0% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  24::207  5.9e-05 27.6% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   2::200  6.7e-05 26.6% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  15::208  0.00027 28.7% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  28::210  0.00046 27.7% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  32::63   0.00057 56.2% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  27::134  0.00079 25.7% 0051942 00519421 1/1   p containing nucleoside triphosphate hy 
  32::185  0.00088 26.1% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRFENVGLRYGLGPEILRDLNFAIPAHSFQFLTGPSGAGKTSLLRLLFLSLRPTRGLVNLFGNDVSLLT
00390411   1/1  ---Mknlslrygn.fralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrg
00509431   1/1  Mlelknlslsnfr...vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdl
00422801   1/1  -llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkll
00378981   1/1  lpllelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldlll
00379581   1/1  lepllevenlsksy.ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldit
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00367901   1/1  -lelknlslsyg..ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlil
00440861   1/1  Mpllslgepllelenlsksy.ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGK
00475891   1/1  lllelllevknlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkd
00500441   1/1  lllelllelknlsksyg.gvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkd
00425571   1/1  -lelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllals
00436071   1/1  pllelenlsksygg..lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla.
00466931   1/1  ----------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGe
00361211   1/1  plellgepllelenlsksyg.gitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvll
00482201   1/1  llllelknlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilg
00502741   1/1  -lllevenlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilg
00404101   1/1  --elenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltals
00490801   1/1  -llllllllalllelleeeeellllllalllllgdpllelenlsksyg.gvpalkdvsltikpGeivalv
00466971   1/1  llalllevknlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00510251   1/1  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksy.ggvpalkdvsltikpGeiva
00530591   1/1  llllllaleelpllgelllevknlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllk
00482261   1/1  -lllevenlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdild
00475991   1/1  lllaaelpelgelllevvnlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsG
00485451   1/1  -------------skiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkplllt
00458601   1/1  -lllevenlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditg
00495371   1/1  ---------esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllk
00469451   1/1  allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdv
00424961   1/1  lgepldglgplrpapgllelenvsksygtg.ialidlslpigkGervalvGpsGaGKttLlrliaglldp
00372301   1/1  yvlPllsdgmpllelenlrkpy.ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggi
00488521   1/1  lllllalelllevenlristgike.ldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei
00436511   1/1  ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGe
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtg.ialidvsltigrGe
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiy.tgipal.dvslglgGlppGeivlllGpsGsGKT
00367481   1/1  yvrPelldepllelengrhPllsksyg.gkvvlndislsip.gellvitGPngsGKSTllralaglllpa
00496111   1/1  ---elenltklyt.gikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliigle..
00500611   1/1  pgllsllelllelenltklp.tgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgei
00503371   1/1  ----------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpds
00379601   1/1  llelenlsfsygg.kealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel...
00381441   1/1  ----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprl
00437981   1/1  lveklrpknldkvig.qeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgk
00422141   1/1  dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlieliflde
00448931   1/1  -----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla
00485931   1/1  ----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi....
00468601   1/1  -------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraa
00457311   1/1  -------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyk
00462761   1/1  ----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr.
00475521   1/1  --------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv..
00495031   1/1  lsalellleledltkis.tgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplgg
00478411   1/1  -------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrl
00475371   1/1  ----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi...r
00464791   1/1  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi.vlidvslpigkGe
00414121   1/1  -------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilid
00532531   1/1  --------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleg
00371631   1/1  mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgk
00480471   1/1  ---------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeil
00477971   1/1  -------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisv.....sgtt
00512891   1/1  ----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv....
00379961   1/1  -yrpvdfddivGqee.alralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdl
00475381   1/1  -------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavls
00515531   1/1  --------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidg
00387201   1/1  mssgepllevenlskryg.gklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptft
00487021   1/1  -----------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddll
00426051   1/1  -------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlg
00368501   1/1  ----------kerllllelrnvllddviGqe.eakealsealelplkrpelfdglgvelpgknvlLvGpp
00368571   1/1  --dgdglgvllGkll...dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkge
00464411   1/1  -------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsge
00490731   1/1  -------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp....
00478441   1/1  -------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll
00434401   1/1  Mlsksygg......llalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrp
00515511   1/1  --------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidg
00484101   1/1  --------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrld
00503741   1/1  ---fifldlrplallplpdrlvgrdeeiealskalgg...aldgvslsiepggivllvGppGvGKTtLak
00510561   1/1  -----------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGg
00533501   1/1  -------------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldge
00468951   1/1  -----------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllg
00498531   1/1  -----------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGg
00379261   1/1  ---------------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLv
00496571   1/1  ---------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepir.
00356411   1/1  ---lknlsksyg.ilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvk
00508671   1/1  ------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvl
00437941   1/1  -lrplveklrpknlddvygqe.evlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrv
00404191   1/1  -vtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa...
00493431   1/1  ----------------------------kGelivllGpsGaGKsTllkllagllgptsgvis.....vgg
00451571   1/1  ----------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl....
00532471   1/1  -------------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlg
00439861   1/1  --kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle...es
00406781   1/1  ---------------lllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisa.........
00392701   1/1  ---------------laledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvda.........
00470731   1/1  ---------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTla
00498811   1/1  -----------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvivi...dg
00477011   1/1  -----------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvg
00499191   1/1  ---------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd.........
00367291   1/1  -vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanelgapfirv
00489571   1/1  ----rvknlsksyggk.talddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.............
00480441   1/1  ----------------------------rlivllGpsGaGKsTlaklLaell.p.....glivisvgdtt
00480251   1/1  -------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr.
00420941   1/1  ------------------lglslgirpgkgvllyGppGtGKTtlakalagelgapfiridg.........
00386741   1/1  ---------------ealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrlda.........
00405881   1/1  ---------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvv
00513761   1/1  ----------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparan
00513251   1/1  --------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr...
00394721   1/1  ---------------ealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv..
00437921   1/1  --------------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaral
00527261   1/1  ---------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel
00482551   1/1  ------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaan
00437901   1/1  --------------------lslgirpgrillLyGppGvGKTtlakalakel.....gapvieidaselr
00489631   1/1  ----------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddll
00432181   1/1  ---------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgv
00402371   1/1  -vllddviGqeealeallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrld
00473941   1/1  ---------------evkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga.........
00521551   1/1  --------------------lslglrpgkgvlLvGppGtGKTtlaralagllga................
00511381   1/1  ---------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilv...kdaid
00499331   1/1  ---------------------PslslkkgklivltGppGsGKtTlakaLaerl.......glpfidtddl
00533151   1/1  ---------------------MsldikkgklivltGppGsGKtTlarlLaerl.......glpfistddl
00444381   1/1  --------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspai
00515351   1/1  ----------------------------mngklivltGppGsGKtTlaraLaerl.......glpvistd
00416171   1/1  -----diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte.
00482661   1/1  -kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqk
00517691   1/1  --------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.......
00457851   1/1  -------------------------PkgklivltGppGsGKtTlakaLaerl.......glpvistddll
00461621   1/1  -------------------------mkgmiialtGppGsGKsTlaklLaerl....glpfistddlyrev
00430121   1/1  ---------dvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfp.....
00482721   1/1  ---------------------------kgkiigltGpsGsGKsTlarlLae.l.......glpvidtddl
00410531   1/1  ---------------gelknlslelkkglkillvGlngvGKTtllkrlag....................
00497571   1/1  ----aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvd
00496061   1/1  ----------------------------gklivltGppGsGKtTlaklLaerl.......glpvistddl
00478391   1/1  -----------------------msikkgklilltGppGsGKtTlaralaerl.......glpvidgddl
00469161   1/1  -------------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgf
00476071   1/1  ---------------------------kgkiigltGpsGsGKsTlaklLae.l.......glpvidtddl
00489391   1/1  ----------------------lsikkgklivltGppGsGKtTlakaLaerl.......glpvistddll
00519581   1/1  --------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaell...
00493171   1/1  ----------------------------mgklivllGpsGaGKsTlaklLaekl.......glivlsvgd
00495771   1/1  ---------------galldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtT
00516041   1/1  ----------------------------mlkgklillvGppGsGKtTlaralaeel....glpfvvidad
00472911   1/1  -----------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglage
00418301   1/1  -vllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakllgr....
00474201   1/1  --------------deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGt
00509891   1/1  ---------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld
00420081   1/1  -------------------------------smkkglrIaleGpsGvGKTTlaklLarhlgpt-------
00519421   1/1  --------------------------pgglvlitGpmgsGKTtlllrllkrleeagkkvlvf..kpaldt
00487061   1/1  -------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvv


                         -         -         *         -         -         -         -:140
query           KDEVSALRQRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLKWVGLGERMDALPPVLSG
00390411   1/1  adkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgi
00509431   1/1  iflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdi...slldlrelrrli
00422801   1/1  agllkptsGeilldgldilalslae...lrrrigyvfqdpalfp.ltvrenlalglllallllglskaea
00378981   1/1  lslaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellellglddlldrlvge
00379581   1/1  alslael..rrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellel
00420701   1/1  llslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellellglddlldrlvge
00367901   1/1  kgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdi...slldlrelrrligyvpqdpal
00440861   1/1  StLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlv
00475891   1/1  ilgls..llellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalralllllllgletlldrlv
00500441   1/1  ildlsl.....lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgledlldrlv
00425571   1/1  l.....lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellglddlldrlvgeLSg
00436071   1/1  .......lrrgigyvfqdpalfpgltvlenlalgllllgll..ealaralellellglgdl.drlvseLS
00466931   1/1  illdgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllll
00361211   1/1  dgleisalslaer..lragigyvfqdlalfpeltvlenlalg.............rarellerlglail.
00482201   1/1  lslkel....rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldr
00502741   1/1  lslael....rgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellellgledlldrlpseL
00404101   1/1  lael...rrgigyvfqdpalfpgltvrenlalgll.....kaeararalellellgldelldrlvgeLSg
00490801   1/1  GpnGsGKSTLlkllagllkptsGeilidgkdi...tglspqelrrlgglvlqdvllffltll........
00466971   1/1  lglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletll
00510251   1/1  lvGpnGsGKSTLlkllagllkptsGeilidgkdi...tglspqelrrlgglvlqdvllffltll......
00530591   1/1  ptsGeilldgkditdlslkel....rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalra
00482261   1/1  lslael....rgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlld
00475991   1/1  eilldgkdildlslael....rgigyvfqqdallpsltvlenlllglllagellllllaakeaalralll
00485451   1/1  ggkvlvigldifrlsa...relrkrig.vfqdpallphltvpenldlglll......eilervlellelv
00458601   1/1  lspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllg
00495371   1/1  p...evlvdgldltglspa.....rggiglvfqteallppltvrenlealgldlrglld...rerviell
00469451   1/1  lylsleesleqlrrrigyvfqdpalfp.........................aeellelvgledlldrlp
00424961   1/1  dsgeilldgvdigersrevtelleel...rrviglvfqdpplfprltvaenialgaeyfrdegadvllla
00372301   1/1  lvdgedlr.............igyvfq..................................llervgled
00488521   1/1  ..................ggkvlyvdqeeslfp.ltvlenlalg...........gedveellerlgl.d
00436511   1/1  rvglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpa
00468691   1/1  rvglvGpnGaGKttLlkllagllkpdsgeilvdGedlr.....elrelrrrigyvfqdpalfpeltvlen
00498251   1/1  tLalrllagllkpgggvvyidgeesldll......rarrlgvvlqelllfpeltveenl...........
00367481   1/1  sggilvpgedalll...............................................rvdeiltrv
00496111   1/1  .lsaeelrerrrrigyvfqepalfpeltvlenlalgll..........................drlpge
00500611   1/1  llggkvlyislee..slrrrrigmvfqelgldpdltv.................arerviellelvglle
00503371   1/1  geirldgkdlliylsdlir.rgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllng
00379601   1/1  ......lrnkigyvfQdpvlfp.ltvren.........................................
00381441   1/1  gevdgvdltfls.......reeigyvfqepallpdltvlenlylglllalllaleegkivildgdrerae
00437981   1/1  di...........rrgiglvfqliglfphltvlelvalgl......ggilveevrellkel.........
00422141   1/1  eellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlgl
00448931   1/1  ......areqlgivfqdp....gltvlenlalg.........eleararellellgledydvvliDtagr
00485931   1/1  ........rrigavpqlpvlfprltvlenlalg.......gadlaeraeellellglegfdvvliDtagr
00468601   1/1  aae....rlgigavpqdvplfpsltvldnlalar..dlleaakaagydvvlidtaglld.ldrlvgelsg
00457311   1/1  lsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk........llepvglpevldryph
00462761   1/1  ........lglliglvfqdpdllpfltvlenvllpllaagliv.....ivdgtlllvglrealrkllgll
00475521   1/1  ...dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp.
00495031   1/1  kvlyiglelt.lsperlrlraqsl..........................gldldellerllvidllelv
00478411   1/1  glkd......gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypdel
00475371   1/1  rpsarellgllgell........................................gldvlvgarggdlsg
00464791   1/1  rvglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerpre....vrellglllelgvlf........
00414121   1/1  gqll...edlgvlavrlgigyvpqtlglfpaltvlellalall....lredpdlilid............
00532531   1/1  gfyakaigllrrkigyvfq...lfpfltvlenvalgld..glvdeedleraenllalvgleeipnrypse
00371631   1/1  lalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeql....krigl
00480471   1/1  ldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvi
00477971   1/1  rpprpgevdgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveellea.gldvlldidpqglsg
00512891   1/1  ....rsarrgigyvfq........tveellgllaelvgle............vrgeleellktlikelsg
00379961   1/1  ldpkdlrellragiplvflnfaalpasllesel.....................................
00475381   1/1  rdllgllreglirigyvfqdyalfprltvlenvllgll........................llgglvvi
00515531   1/1  vklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvp
00387201   1/1  lvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpa-------------
00487021   1/1  ra............gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl..lldri
00426051   1/1  gesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviellle.
00368501   1/1  GvGKTtlaralakllgapfiridgseltek.dyvGesvearlrelfeeaigyvfqdpalfpg.tvlenla
00368571   1/1  yaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilala
00464411   1/1  plge.......ligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdla..ypgf
00490731   1/1  ........yrpaadellgvlaee...............................lgldvllgarggdlsg
00478441   1/1  .....elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld...drypyel
00434401   1/1  aaell.lreglgidfqlpdal......................drellreevlellglgevvivdvydls
00515511   1/1  vklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvp
00484101   1/1  ldellg....igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelal
00503741   1/1  llagllkpkfgeillfg......................................kvvyvnvselldlke
00510561   1/1  lprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql.....rarrlgldldrlllldal
00533501   1/1  pigtp.......lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvgl
00468951   1/1  iGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr.....arrlgldlddllll
00498531   1/1  lprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql.....rarrlgldldellllpal
00379261   1/1  GppGvGKTtlaralAkllgapfvevdas....elteggyvgedlekrirelfqearllvfltvlenirld
00496571   1/1  ....geplgelirglvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlaygfprt
00356411   1/1  ltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpii
00508671   1/1  ldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalglelrdelrellkeaglpll.
00437941   1/1  lgidaselld............................................................
00404191   1/1  ................................................................delvsk
00493431   1/1  ttreprpgevrgigyvfqsgalfphlivagnllegaevhgllygtskerveeale....kgllvlldrdl
00451571   1/1  ......lreaiglvtqdgelllelid.egilvpdeiv.......iellrealeeldadgvildgfprllg
00532471   1/1  rdvgelggaalldivde....grliglvfqdldllpllevlellaa.......................r
00439861   1/1  reqlleraerlgldleellllgll..................................siliadplglsg
00406781   1/1  .........................................................sellgkyvgelsg
00392701   1/1  .........................................................sdllgkyvgelsg
00470731   1/1  ralakel..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidall.rkgpdvildg
00498811   1/1  ddltrelvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldv
00477011   1/1  ggpgtrrptelrlsetpgltvlvvflel.gerldllglvfqdfsllpelielenralagpiagisrdair
00499191   1/1  ........gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldrypr
00367291   1/1  da..................................................................se
00489571   1/1  ......................................................................
00480441   1/1  repregevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealda.glgvlldgfprglsq
00480251   1/1  ...............psapeqlgilgellgvpvvgvltgldlagalrealell.......llegydvvli
00420941   1/1  .........................................................sellgkyvgelsg
00386741   1/1  .................................................................selsg
00405881   1/1  eldd................grqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplld..
00513761   1/1  lpeqlgidirdlidletvmelglgpngalvfaleellttldillealelleedydyiliD..........
00513251   1/1  ......................................................................
00394721   1/1  ......................................................vrldlsellsvsdlvg
00437921   1/1  arlllgsgggvdvieldasdl..rgvddlreligevlqalglllgg........................
00527261   1/1  ..gkpviyidlselsskgyvdleellrelaeelgell....................ellkkllkklsel
00482551   1/1  aalplelgklggkvlyisteeafsperlreralsl.......................gldleelldrll
00437901   1/1  d........................................................vddlsgyvgelsg
00489631   1/1  rellgel...lgrgigfgfqqgdlledatvlenlalllldeidka...................ledggv
00432181   1/1  veldgrkl.....................................................vliDtpGle
00402371   1/1  aselle......................................................fgkyvgafeg
00473941   1/1  .........................................................pfielsasdllg.
00521551   1/1  ..................................................pfvrlsaselvg..kyvgel
00511381   1/1  trlgielvvsriglvleavglffaldllelll......................................
00499331   1/1  lrepvigagtdigevfqdlllaggllvddev..............rrlllealdell...laggkvvild
00533151   1/1  lrelv.pggldigevfqda.leaglllfddefrglller..................leellargpvvil
00444381   1/1  rrllellgarpgenvlLvGppGtGKTtlakalakllgvpfiridgseltekelvGe..............
00515351   1/1  dllreavpg.gtdigelfqdyllfpfltvdeni..............rglllealeellaag.kvvildg
00416171   1/1  .....................................................dlleselfghekgafgg
00482661   1/1  klvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlklf
00517691   1/1  ...........................................gtlllllgllsfllalvldslplerer
00457851   1/1  reavpg.gtrlgeviqdlfllggllffdeldel...........lkerieellaag.gvildgfpldleg
00461621   1/1  vergtelgklikdyfdpgalvpdllirlllerllfldegggflldgfp.rtleqaeals.......kpav
00430121   1/1  ....................................................sgvpfirinlseltekll
00482721   1/1  yrelvaggtplgerirellgegyllpdea........lfrallaellfgdllalalldgvvydrlrdell
00410531   1/1  .........................................................gefvdygptigvn
00497571   1/1  fddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pfir
00496061   1/1  lreevepggtdlgeifqalllagel.lfddevlgll......rerldelielllagg.vvildgfpldle
00478391   1/1  lrelvgeggrlgrdlfdedrllfrellideidl.....................................
00469161   1/1  gtplgel..irelllegfqdlilvpdllvlellaan.....ragl..relikellaa.gkgvildrfpls
00476071   1/1  tregvllggpllerirellgegyllfdealdrellaallfglelegal......................
00489391   1/1  reavpg.gtdlgelfqdlllegellfideiaelllealae..............................
00519581   1/1  fgdvgglvvdli..........................................................
00493171   1/1  ttrepregevdgvdyvfvsgelfkelidagelledaivigllyergtlldavegalld.........gfp
00495771   1/1  rdvllirle..glvliD-----------------------------------------------------
00516041   1/1  dl.....lrgeelgriielfdearelvpelallfideidell..........................ak
00472911   1/1  ggkpl................................................................g
00418301   1/1  ..............................................................pfirvdas
00474201   1/1  GKTtlaralanelprslpglpfvrvnasdltd..vglleellgkllgaat....................
00509891   1/1  .................................ldeplgvdr..erlrrvgelalllaggglcalvaddl
00420081   1/1  ----------------------------------------------------------------------
00519421   1/1  ryl.glvasriglsleailvtllldlfelllrlllrgdidviliDEaqflddelveqlrllanl------
00487061   1/1  iyepvdywaavgggdllrlirelllrlgfgepdafdnellgellealleg....................


                         +         -         -         -         -         *         -:210
query           GEKQRAAIARAVIGRPQLLLADEPTGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINLMDQYEARRMVL
00390411   1/1  glvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglk
00509431   1/1  gyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeelelig
00422801   1/1  raralellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellre
00378981   1/1  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladr
00379581   1/1  vgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvt
00420701   1/1  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladr
00367901   1/1  fpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeel
00440861   1/1  llviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnl
00475891   1/1  seLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrlad
00500441   1/1  seLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrla
00425571   1/1  GqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilv
00436071   1/1  gGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv
00466931   1/1  ellallldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglg
00361211   1/1  drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilv
00482201   1/1  lpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea.rl
00502741   1/1  SgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladril
00404101   1/1  GqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrl
00490801   1/1  ..lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetra
00466971   1/1  drlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldeal
00510251   1/1  ....lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpet
00530591   1/1  lllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gl
00482261   1/1  rlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseal.
00475991   1/1  llllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvl
00485451   1/1  gldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtii
00458601   1/1  ledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHd
00495371   1/1  elvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtv
00469451   1/1  gelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH....
00424961   1/1  dsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDe
00372301   1/1  lldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdle
00488521   1/1  lldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlak
00436511   1/1  llrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftllsrl----
00468691   1/1  lalgallag................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgld
00498251   1/1  ....................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellr
00367481   1/1  glsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvv
00496111   1/1  ldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdlee
00500611   1/1  lldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvth
00503371   1/1  lgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleele
00379601   1/1  .......laralrqdPdilllDEptsalda....ellqallt....ghtvvlvthhlntaldladriivl
00381441   1/1  ellellgldadlviilpasleellerldrrggelsggqkqRval--------------------------
00437981   1/1  ...lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsellpal
00422141   1/1  sy.gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp..............
00448931   1/1  lrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltvlvvthlDll
00485931   1/1  grrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvthddgt
00468601   1/1  gqkqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKlDgtakgghdlslal
00457311   1/1  elsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlgeag
00462761   1/1  sgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.ieev
00475521   1/1  ..sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveeilel---------------
00495031   1/1  gllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilv
00478411   1/1  sggqrqrvaiaralalepelllldeptsaldplavvellelllglnee........ldiilalelllld-
00475371   1/1  glrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadr
00464791   1/1  ..................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEpt
00414121   1/1  ......sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiD
00532531   1/1  lsgGqqqrv...........illldEPtsgLdpvsr...........................leladri
00371631   1/1  lfq.kglpealdveellellldlke....................gledilvpvlsggqkqrlalaralv
00480471   1/1  lllnkidllddrllrraeaeerieellel-----------------------------------------
00477971   1/1  gqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealelldrilv
00512891   1/1  gekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladriall
00379961   1/1  lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpag
00475381   1/1  ldggvrqrlalarallldpdvllldepllllda-------------------------------------
00515531   1/1  illvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalara--------------------
00387201   1/1  ----------------------------------------------------------------------
00487021   1/1  ppalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadp
00426051   1/1  gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellelle
00368501   1/1  lgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallggg--
00368571   1/1  eepeptldellellselglrdladrleklvagglagllegaektaasilellrkllallldlggpafdlr
00464411   1/1  lsggeqqrvaiarallpkpdlvllldepteeldeRllkRg.rllek...leyikkrlehylelaepykdd
00490731   1/1  glrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdat.lgleaadril
00478441   1/1  sggerqrvailr..vllpklllpdepgrnldvlievavlnlilkl..lgidallelvdr-----------
00434401   1/1  ggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrlkrlg
00515511   1/1  illvlnKiDlleaklvllllvglfdlldglpselsggqkqrvalara-----------------------
00484101   1/1  plilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildlllellee..-----------
00503741   1/1  llrlllealglp.....ppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrl
00510561   1/1  tv...............................eellalaerllsggkvdlvviDsltalapalelslll
00533501   1/1  sdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrleh
00468951   1/1  paltveellala...............................erllsggkpqlvviDsltalrpallll
00498531   1/1  tveellala...............................erllsggkpdlvviDsltalapslllldep
00379261   1/1  aseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglg
00496571   1/1  lsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevlehrleraeelad
00356411   1/1  lvlNKiDlleekive.ellellgleykgdrdpeelsggqkqrvalaralakdpdi---------------
00508671   1/1  vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi...-------------------
00437941   1/1  ...pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrlee--
00404191   1/1  lsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqal
00493431   1/1  sggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvi--------
00451571   1/1  qaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallk---------------
00532471   1/1  leellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdl
00439861   1/1  eellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelildalag
00406781   1/1  glrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviatt--
00392701   1/1  glrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviatt--
00470731   1/1  agrtpeqlealldllee......lgrpvvviilttnrevlldral.rRpgrllldep..eldpp------
00498811   1/1  vilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividndl
00477011   1/1  leielpglpdltlvDtPGlgsva..vvdqlsggqkqrvalarallknpdtlillv---------------
00499191   1/1  llsggqrqrvaia.....dpdvlildgptl----------------------------------------
00367291   1/1  lle..klvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelrvls--
00489571   1/1  ...lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.aDrva
00480441   1/1  aqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleeale
00480251   1/1  Dtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaa
00420941   1/1  glrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviatt--
00386741   1/1  geklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllpsgvlvi--
00405881   1/1  ...qpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee......lggtvvlvSahd
00513761   1/1  ...................................tpGglelrallalllaiaralaadeillvddptsg
00513251   1/1  gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvlll
00394721   1/1  elegglrgllteala.lakpsvlflDEi.drlldardsesslevlnaLlrlledg...nvlviattnrpe
00437921   1/1  ....................................kpdvlllDEi.drldpdaqnal------------
00527261   1/1  ..lglsilglelilglsggdleelleelaellkklgkpvililDEiqslldvsskelleaLlrlldeg--
00482551   1/1  vidatdlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlL------
00437901   1/1  geklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliilttndpeeldp--
00489631   1/1  vlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvi
00432181   1/1  efa.......sggekqrvalalallreadvlllvvdadeptsfldle....ll-----------------
00402371   1/1  glrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...nvrviaatnrpelvkl
00473941   1/1  .esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvvelllllp-
00521551   1/1  egglrqllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnvlviaat--
00511381   1/1  ..............qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfage-------
00499331   1/1  gfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeelt------
00533151   1/1  dgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlerylklyerlie
00444381   1/1  .......................................................segailsggfkqr--
00515351   1/1  lsggllqrvallrallrpdlvifldapleelleRllkR....................d.dseeeilerl
00416171   1/1  gekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivlp---------------
00482661   1/1  lkgpellldlglpkgrgllLyGPpGtGKTtlakalanel..ggpvi......................--
00517691   1/1  gitidvalarllldgrkilllDtP.Ghed.....fvkevlralrladgallvvdadegvslpqtrevlll
00457851   1/1  aealreallragplpdlvifldapleelleRllkrgrep................lddteevilkrlerl
00461621   1/1  lsggrkqrlalaralavdpe.lild---------------------------------------------
00430121   1/1  vselighppg.yvGedelgvlfeaarkappsvlllDE.idkldpdvlnaLlqlleegevtdlggrvvd--
00482721   1/1  aelsggqgdvliiegalllepgllplpdlvifldappev-------------------------------
00410531   1/1  fktvevdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpii
00497571   1/1  vn....................................................................
00496061   1/1  galllrealarallpdl.vifldapleelleRllkr...........grllereddseevlekrleryle
00478391   1/1  ............llakgkvvildgtnlsealdealrrllr........pdlvifldapleelleRllk--
00469161   1/1  rlayqlsggerqrlaidlegalllerllldepfpdlvifldaspeelleRllkRgreergrdldteevie
00476071   1/1  ..ldglvygvlqdrllerllaagpd---------------------------------------------
00489391   1/1  .............aegkvvildgtg..ldieqrealrelllelprpdlvifldadpeelleRllkrglr-
00519581   1/1  ....dleaverhlldiaeellengeilild----------------------------------------
00493171   1/1  vlldgalqlllllrelllkpdlvi----------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00516041   1/1  gkvvildgtgrlleldealellgpdlvifldap....peelleRllkr.......gldeeaieerlerlr
00472911   1/1  llfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvifldadp---
00418301   1/1  elte.....aelvGyesgarlrelfaragigllaladpgvlflDEidkllpargssggdv----------
00474201   1/1  .........................................fllakpgvlflDE.idkldpdvqnaLl--
00509891   1/1  agaleel.laralaggpdviliE.gagllplpliellrdlldlvvlvvldgivllvda.....idrleaa
00420081   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00487061   1/1  ......................gkivlsarraqlleirlirplla-------------------------


                         -         -         -         +         -         -         -:280
query           HQGRLHIYE-------------------------------------------------------------
00390411   1/1  eeaek-----------------------------------------------------------------
00509431   1/1  plldg-----------------------------------------------------------------
00422801   1/1  lak.gltvll------------------------------------------------------------
00378981   1/1  ilvlddGr--------------------------------------------------------------
00379581   1/1  hdlde-----------------------------------------------------------------
00420701   1/1  ilvlddGr--------------------------------------------------------------
00367901   1/1  lellg-----------------------------------------------------------------
00440861   1/1  fpglv-----------------------------------------------------------------
00475891   1/1  rilvlddG--------------------------------------------------------------
00500441   1/1  drilvldd--------------------------------------------------------------
00425571   1/1  lddGrive--------------------------------------------------------------
00436071   1/1  v---------------------------------------------------------------------
00466931   1/1  dlldrpvst-------------------------------------------------------------
00361211   1/1  thdld-----------------------------------------------------------------
00482201   1/1  adrilvld--------------------------------------------------------------
00502741   1/1  vlddGriv--------------------------------------------------------------
00404101   1/1  adrilvld--------------------------------------------------------------
00490801   1/1  ellel-----------------------------------------------------------------
00466971   1/1  rladrilvldd-----------------------------------------------------------
00510251   1/1  raell-----------------------------------------------------------------
00530591   1/1  tvllvtHd--------------------------------------------------------------
00482261   1/1  ladrilvl--------------------------------------------------------------
00475991   1/1  lvtHdlse--------------------------------------------------------------
00485451   1/1  lvth------------------------------------------------------------------
00458601   1/1  ldealrla--------------------------------------------------------------
00495371   1/1  llvthdlee-------------------------------------------------------------
00469451   1/1  .....-----------------------------------------------------------------
00424961   1/1  ptsalDge--------------------------------------------------------------
00372301   1/1  laalladr--------------------------------------------------------------
00488521   1/1  elgvt-----------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  alr.e.il--------------------------------------------------------------
00498251   1/1  rllrl-----------------------------------------------------------------
00367481   1/1  tHdlelaa--------------------------------------------------------------
00496111   1/1  aedladsg--------------------------------------------------------------
00500611   1/1  dlrev-----------------------------------------------------------------
00503371   1/1  ellkelek--------------------------------------------------------------
00379601   1/1  ddGri-----------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00437981   1/1  lsrcq-----------------------------------------------------------------
00422141   1/1  .ie-------------------------------------------------------------------
00448931   1/1  akgga-----------------------------------------------------------------
00485931   1/1  akggaals--------------------------------------------------------------
00468601   1/1  rladr-----------------------------------------------------------------
00457311   1/1  rsadrvl.--------------------------------------------------------------
00462761   1/1  adrilallegr-----------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  thdlr-----------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475371   1/1  ilvldlg---------------------------------------------------------------
00464791   1/1  sgldal..r-------------------------------------------------------------
00414121   1/1  llselthdl-------------------------------------------------------------
00532531   1/1  yvlls-----------------------------------------------------------------
00371631   1/1  edpdvl----------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00477971   1/1  ll--------------------------------------------------------------------
00512891   1/1  rrgrivelgp------------------------------------------------------------
00379961   1/1  vtviaatn--------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00487021   1/1  ee--------------------------------------------------------------------
00426051   1/1  rlare-----------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00368571   1/1  dllslgegli------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00490731   1/1  vlleglg---------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00503741   1/1  leegkltdk-------------------------------------------------------------
00510561   1/1  dept------------------------------------------------------------------
00533501   1/1  y---------------------------------------------------------------------
00468951   1/1  deptg-----------------------------------------------------------------
00498531   1/1  grv-------------------------------------------------------------------
00379261   1/1  lpevgelll-------------------------------------------------------------
00496571   1/1  rlialyeg--------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00404191   1/1  lr--------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00532471   1/1  viyldadpe-------------------------------------------------------------
00439861   1/1  ggal------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  sl--------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00489571   1/1  vlddGtpee-------------------------------------------------------------
00480441   1/1  lllai-----------------------------------------------------------------
00480251   1/1  lsvalil---------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00405881   1/1  gegldelld-------------------------------------------------------------
00513761   1/1  ldaet-----------------------------------------------------------------
00513251   1/1  degsl-----------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00489631   1/1  vtddl-----------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00402371   1/1  geldpallr-------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00533151   1/1  pyee------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00515351   1/1  eryreelep-------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00517691   1/1  llllgv----------------------------------------------------------------
00457851   1/1  relyerlie-------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00410531   1/1  lvgnK-----------------------------------------------------------------
00497571   1/1  .---------------------------------------------------------------------
00496061   1/1  lyerliepykk-----------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00469161   1/1  erlervrdey------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00516041   1/1  eileplee--------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------