[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38253.1


[Show Plain Result]

## Summary of Sequence Search
   1::540
  25::417  4.5e-61 30.3% 0047712 00477121 1/1   AD(P)-binding domain                    
  24::414  1.7e-52 31.4% 0046834 00468341 1/1   AD(P)-binding domain                    
  26::400  2.2e-49 29.3% 0052926 00529261 1/1   AD(P)-binding domain                    
   1::335  1.8e-32 26.4% 0037441 00374411 1/1   AD(P)-binding domain                    
  23::334  2.5e-32 25.6% 0050363 00503631 1/1   AD(P)-binding domain                    
  24::355  1.2e-31 25.0% 0041341 00413411 1/1   AD(P)-binding domain                    
  29::345  5.5e-29 22.4% 0052600 00526001 1/1   AD(P)-binding domain                    
  24::341  7.8e-29 24.0% 0049003 00490031 1/1   AD(P)-binding domain                    
  23::370  9.6e-29 23.1% 0052032 00520321 1/1   AD(P)-binding domain                    
  23::340  1.2e-28 22.4% 0036092 00360921 1/1   AD(P)-binding domain                    
  22::355  3.8e-28 26.9% 0035989 00359891 1/1   AD(P)-binding domain                    
   1::341    4e-28 24.7% 0049150 00491501 1/1   AD(P)-binding domain                    
  26::341  6.5e-28 29.8% 0048494 00484941 1/1   AD(P)-binding domain                    
   1::341    2e-27 25.3% 0046270 00462701 1/1   AD(P)-binding domain                    
   1::284  2.7e-26 23.3% 0049222 00492221 1/1   AD(P)-binding domain                    
  25::340    2e-25 25.6% 0047133 00471331 1/1   AD(P)-binding domain                    
  26::230  2.1e-25 26.6% 0046579 00465791 1/1   AD(P)-binding domain                    
  24::341  2.2e-25 28.1% 0046057 00460571 1/1   otide-binding domain                    
  26::384  2.2e-25 25.2% 0047022 00470221 1/1   AD(P)-binding domain                    
  24::343  3.4e-25 28.8% 0040602 00406021 1/1   AD(P)-binding domain                    
  29::317  6.7e-25 22.5% 0045881 00458811 1/1   AD(P)-binding domain                    
  29::346  7.3e-25 26.4% 0040035 00400351 1/1   AD(P)-binding domain                    
   1::339    1e-24 24.5% 0046446 00464461 1/1   AD(P)-binding domain                    
  29::336  4.3e-24 24.9% 0043577 00435771 1/1   AD(P)-binding domain                    
  24::342  5.7e-24 26.2% 0036300 00363001 1/1   AD(P)-binding domain                    
  24::345  6.8e-24 26.5% 0046514 00465141 1/1   AD(P)-binding domain                    
  24::344  7.9e-24 24.2% 0053321 00533211 1/1   AD(P)-binding domain                    
  22::335  8.2e-24 27.7% 0044098 00440981 1/1   AD(P)-binding domain                    
  26::355  1.1e-23 26.3% 0048771 00487711 1/1   AD(P)-binding domain                    
  26::335  1.9e-23 28.7% 0037643 00376431 1/1   AD(P)-binding domain                    
  29::232  3.3e-23 26.1% 0048607 00486071 1/1   AD(P)-binding domain                    
  27::344  3.6e-23 22.4% 0045870 00458701 1/1   AD(P)-binding domain                    
  24::383  5.1e-23 24.2% 0052963 00529631 1/1   AD(P)-binding domain                    
  22::341  3.7e-22 27.5% 0040688 00406881 1/1   AD(P)-binding domain                    
  24::341  4.8e-22 24.5% 0045797 00457971 1/1   AD(P)-binding domain                    
  26::211  6.1e-22 22.4% 0047564 00475641 1/1   AD(P)-binding domain                    
  25::211  9.5e-22 31.5% 0052313 00523131 1/1   AD(P)-binding domain                    
  25::215  3.7e-21 32.1% 0036459 00364591 1/1   otide-binding domain                    
  24::267  5.4e-21 22.6% 0048356 00483561 1/1   AD(P)-binding domain                    
  24::211  8.7e-21 23.0% 0048583 00485831 1/1   AD(P)-binding domain                    
  29::272  1.5e-20 23.4% 0045795 00457951 1/1   otide-binding domain                    
  29::247  4.9e-19 22.9% 0052911 00529111 1/1   AD(P)-binding domain                    
  13::343  6.5e-19 27.8% 0047270 00472701 1/1   AD(P)-binding domain                    
  26::352  7.9e-19 27.1% 0049990 00499901 1/1   otide-binding domain                    
  22::345    1e-18 23.4% 0040049 00400491 1/1   AD(P)-binding domain                    
   3::183  2.4e-18 27.4% 0036889 00368891 1/1   AD(P)-binding domain                    
  24::201  5.2e-18 30.9% 0048807 00488071 1/1   otide-binding domain                    
  25::344  9.8e-18 22.7% 0047029 00470291 1/1   AD(P)-binding domain                    
  29::341  1.1e-17 27.1% 0045518 00455181 1/1   AD(P)-binding domain                    
  25::336  1.3e-17 27.7% 0038074 00380741 1/1   AD(P)-binding domain                    
  23::238  1.5e-17 28.8% 0047141 00471411 1/1   otide-binding domain                    
  27::347  1.8e-17 28.4% 0050927 00509271 1/1   AD(P)-binding domain                    
   1::357  2.8e-17 22.9% 0039664 00396641 1/1   AD(P)-binding domain                    
  17::187  3.8e-17 25.2% 0042446 00424461 1/1   AD(P)-binding domain                    
  24::193  4.2e-17 22.0% 0046274 00462741 1/1   AD(P)-binding domain                    
  11::185  1.7e-16 32.1% 0048866 00488661 1/1   AD(P)-binding domain                    
   6::185  2.2e-16 31.3% 0048045 00480451 1/1   AD(P)-binding domain                    
  21::219    3e-16 21.8% 0040660 00406601 1/1   AD(P)-binding domain                    
   5::185    6e-16 27.7% 0048009 00480091 1/1   AD(P)-binding domain                    
   5::185  6.4e-16 27.7% 0053322 00533221 1/1   AD(P)-binding domain                    
  24::207    7e-16 23.8% 0046128 00461281 1/1   AD(P)-binding domain                    
  29::191  9.4e-16 30.4% 0044413 00444131 1/1   AD(P)-binding domain                    
  24::249  1.6e-15 18.8% 0047682 00476821 1/1   AD(P)-binding domain                    
   4::183  6.9e-15 24.6% 0047565 00475651 1/1   AD(P)-binding domain                    
  25::343  1.1e-14 26.4% 0046416 00464161 1/1   AD(P)-binding domain                    
   3::341  1.4e-14 23.3% 0048199 00481991 1/1   AD(P)-binding domain                    
  25::219  3.8e-14 29.1% 0046750 00467501 1/1   AD(P)-binding domain                    
  24::202  4.6e-14 25.7% 0047068 00470681 1/1   AD(P)-binding domain                    
   7::185  4.9e-14 24.1% 0038449 00384491 1/1   AD(P)-binding domain                    
  25::211  1.1e-13 27.8% 0048865 00488651 1/1   AD(P)-binding domain                    
  25::344  1.9e-13 25.2% 0046760 00467601 1/1   AD(P)-binding domain                    
   2::183  6.7e-13 25.0% 0036654 00366541 1/1   AD(P)-binding domain                    
   8::187  6.7e-13 31.2% 0050961 00509611 1/1   AD(P)-binding domain                    
  11::185  1.7e-12 27.5% 0038468 00384681 1/1   AD(P)-binding domain                    
  26::208  1.7e-12 26.9% 0046156 00461561 1/1   otide-binding domain                    
   6::185    2e-12 25.7% 0047271 00472711 1/1   AD(P)-binding domain                    
  10::184  2.2e-12 27.8% 0044705 00447051 1/1   AD(P)-binding domain                    
   1::186  2.8e-12 25.0% 0048584 00485841 1/1   AD(P)-binding domain                    
  29::220  3.4e-12 21.3% 0047327 00473271 1/1   otide-binding domain                    
  26::183  7.2e-12 31.2% 0048365 00483651 1/1   AD(P)-binding domain                    
  16::185  7.4e-12 31.4% 0049679 00496791 1/1   AD(P)-binding domain                    
   2::185  7.7e-12 28.6% 0048200 00482001 1/1   AD(P)-binding domain                    
   5::185    8e-12 25.7% 0036301 00363011 1/1   AD(P)-binding domain                    
  22::342  1.8e-11 25.3% 0050148 00501481 1/1   AD(P)-binding domain                    
  27::199    6e-11 25.7% 0047909 00479091 1/1   )-binding Rossmann-fold domains         
  27::212  8.3e-11 30.7% 0050960 00509601 1/1   AD(P)-binding domain                    
   6::185  9.2e-11 28.4% 0046972 00469721 1/1   AD(P)-binding domain                    
   3::204  3.7e-10 24.8% 0045519 00455191 1/1   AD(P)-binding domain                    
   9::186    1e-09 27.2% 0046761 00467611 1/1   AD(P)-binding domain                    
  25::214  1.8e-09 26.4% 0048016 00480161 1/1   otide-binding domain                    
   8::185  2.1e-09 28.7% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
   8::64   4.3e-09 38.6% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
  27::474  8.5e-09 24.1% 0048364 00483641 1/1   AD(P)-binding domain                    
   4::185  8.6e-09 30.2% 0046973 00469731 1/1   AD(P)-binding domain                    
  29::183  1.3e-08 29.3% 0041940 00419401 1/1   AD(P)-binding domain                    
   7::186  1.9e-08 17.8% 0040619 00406191 1/1   AD(P)-binding domain                    
  22::185  2.3e-08 25.6% 0050364 00503641 1/1   AD(P)-binding domain                    
  25::187    3e-08 29.6% 0048108 00481081 1/1   AD(P)-binding domain                    
  12::183  3.2e-08 30.0% 0052964 00529641 1/1   AD(P)-binding domain                    
  22::137  1.3e-07 29.0% 0045481 00454811 1/1    N-terminal domain                      
  11::183  2.1e-07 24.8% 0038285 00382851 1/1   AD(P)-binding domain                    
  29::213  3.6e-07 26.5% 0046344 00463441 1/1   AD(P)-binding domain                    
   7::64   3.8e-07 31.0% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
  26::64   5.5e-06 46.2% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
   8::185  8.9e-06 19.9% 0036016 00360161 1/1   AD(P)-binding domain                    
   8::64   1.7e-05 29.8% 0053172 00531721 1/1   )-binding Rossmann-fold domains         
  29::56   1.8e-05 60.7% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
  27::56   2.2e-05 50.0% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
  23::56   3.7e-05 41.2% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
  27::56   3.9e-05 46.7% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
  26::56   4.5e-05 51.6% 0051213 00512131 1/1   )-binding Rossmann-fold domains         
  20::56   7.3e-05 43.2% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
  23::87   7.6e-05 29.2% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
  27::64     8e-05 43.2% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
   7::183  0.00012 27.3% 0045798 00457981 1/1   AD(P)-binding domain                    
  27::64   0.00038 50.0% 0045718 00457181 1/1   )-binding Rossmann-fold domains         
  29::63   0.00042 40.0% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
  23::56   0.00048 35.3% 0042342 00423421 1/1   )-binding Rossmann-fold domains         
  29::56    0.0006 46.4% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
   4::56    0.0007 28.3% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
  24::56    0.0008 42.4% 0047346 00473461 1/1   )-binding Rossmann-fold domains         
   1::540


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLHQEHFHFGYRRHPDQDRDNDPARHPVVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
00477121   1/1  ------------------------ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggtalgrgg
00468341   1/1  -----------------------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprp
00529261   1/1  -------------------------lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGl
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLaraGlkVtvlEardrlGGrlr
00503631   1/1  ----------------------masmsmkydvvIiGaGpaGlaaAlrLaraGlkvtvlEkgprlGgtwrt
00413411   1/1  -----------------------MpmsseeyDvvViGaGpaGlaaAlrlaraGlkVlllEkgpvlgGtss
00526001   1/1  ----------------------------MseeyDvvvvGaGpaGltaAleLaraGlkVlllEagdrvgGt
00490031   1/1  -----------------------lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVll
00520321   1/1  ----------------------MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlvlEkgpllggtsglng
00360921   1/1  ----------------------pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlErgGrlasgri
00359891   1/1  ---------------------eldeeyDvviiGaGpaGlsaAlrLaraG.kVlvlEkgpvlggtsglngg
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGlkVtvlEardrlGGrs
00484941   1/1  -------------------------aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlGGrsrt
00462701   1/1  MMsp....lllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlllEkgdrlGGtslrsg
00492221   1/1  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlG
00471331   1/1  ------------------------tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyktllal
00465791   1/1  -------------------------mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgrgasg
00460571   1/1  -----------------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggtsgt
00470221   1/1  -------------------------myDVvviGgGiaGlaaAlrLaraGlkVlvlEagdrlGGrlrtvrl
00406021   1/1  -----------------------MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllggg
00458811   1/1  ----------------------------llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrdrl
00400351   1/1  ----------------------------vvvvGaGpaGlaaAlrLaraGlkVlvlErgdrpG.Gtsltng
00464461   1/1  Mm..plslllatalelplpalaldkkyDvvViGaGpaGlaaAlalaraGlkVlllEkgdrlG.Gtsltag
00435771   1/1  ----------------------------VaviGAGiaGlaaAyeLaraGlkVtvlEardrlGGrsrtvgy
00363001   1/1  -----------------------mekydvvviGaGlaGlsaAlelaragldvtvlergprlggcllllsv
00465141   1/1  -----------------------eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggclnvgci
00533211   1/1  -----------------------mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrlngg
00440981   1/1  ---------------------MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllntgcg
00487711   1/1  -------------------------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgr
00376431   1/1  -------------------------eydvvvvGaGpaGlaaAlalaraglkvlllekgprlg.gllvgli
00486071   1/1  ----------------------------myDvviiGaGpaGlaaAlrLaraGlkVlvlEk.drlGGtc..
00458701   1/1  --------------------------ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEagdrvGGrartvr
00529631   1/1  -----------------------mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrt
00406881   1/1  ---------------------MsskeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlgglllagci
00457971   1/1  -----------------------sekydvviiGaGpaGlaaAlrlarlaglkvlliekg.rlggllllla
00475641   1/1  -------------------------lldkeyDVvviGgGpaGlaaAlrlaraGlkvlllEkgdrlgGtcl
00523131   1/1  ------------------------msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlggascrnsg
00364591   1/1  ------------------------mgrvcppcegaclllllagpvailllepaladelllgllplllpam
00483561   1/1  -----------------------MskkydvviiGaGiaGlsaAlrLaraGlkVlllEkgdrlGGtsgrna
00485831   1/1  -----------------------lsedkeyDVvviGgGpaGlaaAlalaraGlkVlllEkgpelggtcla
00457951   1/1  ----------------------------yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlG
00529111   1/1  ----------------------------llsnlplgrllpfllptslwldtlplpllellisraileral
00472701   1/1  ------------ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierglGgtllnggpgl
00499901   1/1  -------------------------kkdvvviGAGiaGlaaAlrLaeaGhkVtvlEardriGGrsrtngg
00400491   1/1  ---------------------MkdleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgplgggascln
00368891   1/1  --ppipgle..llltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlgglld....
00488071   1/1  -----------------------irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdva
00470291   1/1  ------------------------lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLael
00455181   1/1  ----------------------------vvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlgglsnrngi
00380741   1/1  ------------------------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggclnvgci
00471411   1/1  ----------------------mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEkndrlgGrllggi
00509271   1/1  --------------------------vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtil
00396641   1/1  MsylasaallaalpslletieyD.....VlviGgGpaGlsaAlelarlapdaGlkValvEkgdlgggasg
00424461   1/1  ----------------vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGae
00462741   1/1  -----------------------mlMkkkyDviiiGaGpaGlaaAleLaraGlkVlvlEkgdrlGGtwas
00488661   1/1  ----------srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgak
00480451   1/1  -----pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlgglld....
00406601   1/1  --------------------MddlpeeyDVvViGaGlaGlaaAaaLaraGlrVlvlEkrdrlGGtsatsr
00480091   1/1  ----ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld....
00533221   1/1  ----ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld....
00461281   1/1  -----------------------glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVlvl
00444131   1/1  ----------------------------MsdedyDviviGaGiaGlvaAarLakaGlkVlvlEkgdrlGG
00476821   1/1  -----------------------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae
00475651   1/1  ---pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvvereprlggtld....
00464161   1/1  ------------------------MleydvvviGgGpaGlaaAlrlaraGlkvlliekgdrlGGtllntg
00481991   1/1  --klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarlGlkv
00467501   1/1  ------------------------kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlgg....t
00470681   1/1  -----------------------lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvlliekep..
00384491   1/1  ------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvver.drlggtl.....
00488651   1/1  ------------------------mlpkdvviiGgGpaGleaalalarlglklevtliergdrlg.gtll
00467601   1/1  ------------------------MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtlll
00366541   1/1  -vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlgakvtvvergdrlggtld....
00509611   1/1  -------lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglkVtlier
00384681   1/1  ----------ftprvlpipgeeacglltadepvailflerlihsyavkdgppftgkdVaViGaGpaGlda
00461561   1/1  -------------------------gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvpggllryg
00472711   1/1  -----elflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlglkvtllerrprlggtl.....
00447051   1/1  ---------arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlgakvt
00485841   1/1  rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtvvergdrllgtld....
00473271   1/1  ----------------------------MyDviviGaGiaGlaaAyrLakaGlkVlvlEkgdrlGGraat
00483651   1/1  -------------------------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGlea
00496791   1/1  ---------------PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlglkvtl
00482001   1/1  -llpipgle...vltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlvergdrlggtl.....
00363011   1/1  ----ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrlglevtlvergdrll
00501481   1/1  ---------------------lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglll
00479091   1/1  --------------------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlver
00509601   1/1  --------------------------kdvvviGgGpaGleaAlalar.glkvtliergdrlggtrpllsg
00469721   1/1  -----dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergdrllglld....
00455191   1/1  --ppipgve..llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlierrdrllgtl.....
00467611   1/1  --------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrllpcld.
00480161   1/1  ------------------------tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferlprpgg
00533831   1/1  -------lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVtlvDiddelleglale
00472781   1/1  -------ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdideekl------
00483641   1/1  --------------------------ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcll
00469731   1/1  ---dipgle..llltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlvergdrll.pyldcel
00419401   1/1  ----------------------------lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalr
00406191   1/1  ------prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGldaArellkdldl
00503641   1/1  ---------------------epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaa
00481081   1/1  ------------------------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgG
00529641   1/1  -----------ePripdipglleefkgkvlhsaayrdpedfkgkrVvViGaGaSgldialelakvaksvt
00454811   1/1  ---------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpggl......
00382851   1/1  ----------srPrvlpipgldlegvlllrtledalellellelpkrvvviGgGliGlelAaalrellpk
00463441   1/1  ----------------------------VlVvdgGgGpaGleaAealarrGheVtlvealdrlggll...
00472761   1/1  ------ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlvDideekl------
00445591   1/1  -------------------------pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekle------
00360161   1/1  -------fvawynglpdaallepdltgkrVvviGgGpaGldaArlllksldellktdindlalealkrlg
00531721   1/1  -------rrsrlllliglegqeklkgakVaviGaGgvGlalAllLalagvagevvlvDidevkl------
00479921   1/1  ----------------------------pkkvaviGaGavGlalAlalaraGaage--------------
00482271   1/1  --------------------------mkiaviGaGyvGlplAallaeaGheVvgvD--------------
00466731   1/1  ----------------------mlkikkvaViGaGlmGsgiAavlaaaGikVvlvD--------------
00481021   1/1  --------------------------lllmlkmmkiaviGaGavGtalAallaeng--------------
00512131   1/1  -------------------------mkkvaiiGaGyiGlslalllaekgllgkvvl--------------
00425341   1/1  -------------------lsmvlkgkkvaviGaGliGlalalllallglgeVvly--------------
00504431   1/1  ----------------------lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpealeraldeia
00463571   1/1  --------------------------mKiaviGaGyvGlelAavla.lgheVtlvdinpeklea------
00457981   1/1  ------iPglelvltsddaldleelpkrlvviGgGyiGlelAsalrrlgpdaaevtlvergdrl......
00457181   1/1  --------------------------mKiaviGaGyvGlslalllalkgladevvlvDideekl------
00374371   1/1  ----------------------------agrlavleaalllervltglgalagllpgkrvlVi-------
00423421   1/1  ----------------------ldllplfldlrgkdvlviGgGdvGlaaarlllea--------------
00355351   1/1  ----------------------------GkkvaviGlGsmGlalAallaaaGheVl--------------
00480351   1/1  ---gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvla--------------
00473461   1/1  -----------------------klkmhviiiGagrvGrslarlLleegidvvvid--------------


                         -         -         *         -         -         -         -:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
00477121   1/1  alsprglelleelglldallargvpldglvvvdgg.grlaldfaelalgapg..yvvdraellralleaa
00468341   1/1  ggrsrggglypgglellrelgledeleelgvdflkalvvlldldlvlalrllgpdvtggerrpragvvdr
00529261   1/1  aaAlrLlqlAaraGpdlkVtvlEkgdrlGGtsrtnggliprgleelldelgipgalldagfpydgllfvf
00374411   1/1  taripglgasldlggilfpglsprllellaelgle...aelarllglrvlilldgtvvsldgdldfevll
00503631   1/1  .........................grypglllllpallyllldlpllfglpppggggvdraelldylle
00413411   1/1  rnqggirldlgaipldlleelgldlvkggdgltleagalvlatgarpripplpglgvpgvltsdgalalr
00526001   1/1  slrngglphkglreladrlielleelgvelllntvvgalltlaellaeydavvlalglglatglagrgla
00490031   1/1  lEkgprlggtsclnggglppgglrylaglglldlleel..aeelgidldflrdgllvlaldgegleadal
00520321   1/1  ggihaglskllldlrdlleelgvelllggaglvdprgvellgelg.leadalllatGrpfdlpipglelf
00360921   1/1  pgklldggahllpglleellaglgdlaellalkpelvalledgaailllprgvrllaglglggssainag
00359891   1/1  gipgglllddllerlg........edlliglallvdgdlvvvltgegleadalllatGapprlldipgld
00491501   1/1  rtaglippgflldlgahvfpglaplllelleelglelelltlagaavlalldgklidlpadvarlla.ar
00484941   1/1  ggypgfpiidsgallfpellpyllellkelglelrl...............pdlggrvvvlpdgkvlgyd
00462701   1/1  gilldgglrlleglglldrleelleelgieldllvdgrlvvaladealeadalllatGarprllpipgld
00492221   1/1  Gts...rnggvipdgglldpelldlleelGlpfdl..............................llpgg
00471331   1/1  Ggllltvglipgkallgaalllelaelleelgvevtllellggdrvlprldldg..............pe
00465791   1/1  rnaggiapglgyddrllalakeslellkelgael......................gidlfrppgklvva
00460571   1/1  nggllaaglvapllllpggipllalalealdllrelglelgidf....rvgalvlatglaeladalllal
00470221   1/1  gggtsldlggivfpglypallelleelglelallaldgellayldglvlelgidlntlvvaldpdalevl
00406021   1/1  llnagdildklgllaallvrladalvlatga......rprrlgipglelpggrvvvigggvialeeaaee
00458811   1/1  GGtsnggdgrldlgahvfflllppgllellaelglplglelldlleelleelgidfllgkgvg......g
00400351   1/1  gpgfkldlgaalllgpelleelgteaaellaergvrvlrgkglgggstinadavvlatgadprllgipgl
00464461   1/1  gilldlgarlleglglldlleelleelgielrllrdgklvvaltgegleadavllatGarprllpipgld
00435771   1/1  pgfrldlgaglipgsypyllelleelglelair..lntevggavllpdgglltvprdladllaellalad
00363001   1/1  p..................................................ggrldpeelvlalaellee
00465141   1/1  pgkaldaaalllrllelleelgvelr..............lppldglllpgvgdvlgaelaaalaealee
00533211   1/1  ggaaldlpsklllrlldlllelaellarlgaevlrlllglltllergdrllp...........ellrall
00440981   1/1  psklllpgall.............................................gaelveallellee
00487711   1/1  nagllhaglaylelarlaresldllrelveelgidfrrygklvlatgeaelellrelaealralgvdvel
00376431   1/1  psklll..............................................lrvlgaelaaalaealee
00486071   1/1  ...............lnvgcipskallyagllpdelelleelglpllpgldipvlpgrkgggreellryl
00458701   1/1  ypgfrfdlgahvflgpggelleylldlleelgleddlrlntevggarlllpdgkllvltsdlnalllelr
00529631   1/1  tgrigsgldlgpsllrlleelglldelleeg.lsplypglrldvpkelygfpdfplpgwfpvfp.....g
00406881   1/1  pgkallaaalllrllellaelgiellllpypgvdlslv...........plllrvlgaelaaalaealee
00457971   1/1  yggil...........................................lrvgfiplkrlaelleallela
00475641   1/1  nsgcipskalllaalglllllgaalfglllllllllldlvllgaakralgae............llrlla
00523131   1/1  ...........................gglakgllleelpalgg..........vdrarlaaalaeaaea
00364591   1/1  skkkdvvvvGaGpaGlaaAlalaraGlkvtllekgdrlggrlllvg........................
00483561   1/1  glipgglrldaalllvrlalesldalreliatgarplglpipgrdlgglllardaldldalpkrlavl..
00485831   1/1  aggipskallllalgllllelaallgillllllld......................lllllrrllllll
00457951   1/1  Gtsglnaglippglggplddrglalaeetlellrelgaelgl.ldglvrpngalvlaigledadelarlg
00529111   1/1  pdldmdkeyDVvIvGAGpaGLsaAyyLakarPglkVlvlEkgdrpGGasgrnggilpsglltdellelle
00472701   1/1  skpll.............................................................lrvl
00499901   1/1  llipglrldlgahlfpgsyellldlleelgvelrlntrvvvdrdgklvtvpldldgleleadavvlatGa
00400491   1/1  gggipakllledllerlvvdllkggailv...........dedlvelldgealeadalllatGarprlgi
00368891   1/1  .........................................................pelaaallellek
00488071   1/1  viGaGpaGlaaAlalaraGlkVtllEardrlggrlllsgg..............................
00470291   1/1  aGlkVlvlEa......GGtarnggyigskpdlgaalfg.elldelyelgle..ldgrrllfprgkvlGGs
00455181   1/1  pglrlllgalllrllelleelgipfdlpglgglflprggrvdg........................ael
00380741   1/1  pgkrllaaaelydelrelleelgipfdevllglllllgrggadg........................ae
00471411   1/1  pgfalpa....................................................elldalaelae
00509271   1/1  ................................................llggvpsglllgaalllall.e
00396641   1/1  rsgggiaaglrllienylgldlaellvedlvkggaglvdedlveilatgappavleleglgvpflrtsdg
00424461   1/1  vtvierrprlggtllalgripakllglealll.......................rllllllglglllpi
00462741   1/1  ngipgipsdggaavilgpellellrelgielgpkvpeildyllklldkfdllklleflskvngveyiegr
00488661   1/1  vtlvergdrlggtlld......................................................
00480451   1/1  .........................................................pelaaallellek
00406601   1/1  ypGfrfdvggsllpgtipgllrllrelgledlellplglagvirgggsvvnalpdeaeallaelgvlfpi
00480091   1/1  .........................................................eelsllllellek
00533221   1/1  .........................................................eelslallellek
00461281   1/1  EagdrlgGascipsgaglgadlgltllpglfdtll..agldgrdllarrgkvlggsslingmvylrglpe
00444131   1/1  taatlgldglkfdlggsvihgllypallrllrklgldlgpkilhalgelvdlllrtdvsdylefrlldgr
00476821   1/1  .GlkVlvlEaggrlggrgatpsgggflvdtgadwlfgtepelglegrgillprgkvlGGsslinggvlvr
00475651   1/1  .........................................................pelskallellek
00464161   1/1  cipgkalllgalllellrellelgglflllpdldlelllelldalv..............eelaaalaea
00481991   1/1  lliekgprlggtclnvgcipskallkaaelaeliellpglgvelllg......glgldlaellerkdavv
00467501   1/1  pllpgvlggkllaelllrllel...............................................l
00470681   1/1  ..................glgynrgclpkklllaaaelldlllelaglgll.....llvaagdldaeelv
00384491   1/1  ........................................................dcilskallellee
00488651   1/1  plgpgpllglldaeelaey...............................................lrel
00467601   1/1  lggtclnvgcipskllllaallpellelleglgvefdleekgvdldglrlaydklv..............
00366541   1/1  .........................................................pelskallellek
00509611   1/1  gdrlgg.ld.............................................................
00384681   1/1  Alylarlgakkvtlverrdrlg................................................
00461561   1/1  iapd..............................................frlpkelldrlielleelgv
00472711   1/1  ..............................................................dlllelle
00447051   1/1  lierrdrlggtl..........................................................
00485841   1/1  .........................................................pelsklllellek
00473271   1/1  frldgfrvdnvgahpfkgl.npelldllkelgledkldlrrlvllrgkvlggpsdlngllavrgdedlle
00483651   1/1  AlalarlGakVtviergdrlggrll.............................................
00496791   1/1  ierrdrlggd............................................................
00482001   1/1  ........................................................dpelsklllellek
00363011   1/1  lpyl.............................................................rpels
00501481   1/1  yvgcilskall..............................................llgilgeellarl
00479091   1/1  dpr...................................................................
00509601   1/1  vipgkll...................................................deelaeylrell
00469721   1/1  .........................................................pelskallellek
00455191   1/1  ........................................................dpelskallellek
00467611   1/1  ............................................................pelsklllel
00480161   1/1  llrygiapdfrlpk.......................................................e
00533831   1/1  lgdiisllgk............................................................
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  skalg................................................llglldeelalrllell
00469731   1/1  skall.............................................................elle
00419401   1/1  rlgaevtliergdrllpll...................................................
00406191   1/1  llktdisdnaleallarlgaevtvvgRrgpliaaftlkelerlpelggllrygipedkllkeflareia.
00503641   1/1  elakaglevtvfertprigglwrgipypplgkelldyleeyarklglrirfgtevtsvdrdgwtvtgeel
00481081   1/1  yiGlelAaalarllpelgaeVtlvergdrl........................................
00529641   1/1  llersdelggpw..........................................................
00454811   1/1  ...............lllelgvefvlg..slllellleadlvvlspgvpldhpllelarelgievig---
00382851   1/1  lglevtlveagdrllpryldpelsklll..........................................
00463441   1/1  ...........................................................rlgipdpller
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  gkeVtvveRrgpleap....ftlkelrelggllrygippdpldla...llelelellpraldrlv..ell
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  klllklvlkgllvelll-----------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ...........................................................lpyldpelskl
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
00477121   1/1  eelg.veirlgtrvtsileedgdgvtvtledggeeetieadlvvgAdGarsrvrrllgip..........
00468341   1/1  aellralleaaeelGngrveirlgtrvtsierdgelledleeypvtvtlenlseeeakpeelggkvagvl
00529261   1/1  gggfigledargllrlgagvtvvdrgd..llralaeaaeel.GveirlgteVtsierdedgrvtgVtted
00374411   1/1  adgeeleadalilatGa.rprllpipgfdgkgvltardlldllflgkrvvviGggvsglelaealarllk
00503631   1/1  aaerl.gvedvirlgtevtsidfdedgvvvgvttedG.etieadavvlAtGalsrprlppsipgldltfk
00413411   1/1  epgkrvvviggglsglellvgrgdgaa..laralaeaaeal.gveiltgtevteilrdeggrvtgVvtad
00526001   1/1  vprgrvlggssvingavylradaidfatgargipgwdldgvlpyfdrledslgvlglpflgkrvvviGgg
00490031   1/1  llatGapprlldipgldllggrvvvigggvdglelaralaeaaeel.gveillgtrvtellvdeggrvtg
00520321   1/1  gvrglltlldalkleplllssdlaggllypgkrvvvigggaillealaeaaeel.Gveiltgtevteier
00360921   1/1  vylrvspadfdelgawgvtlddlepyfelaadalvlatGsrprlpplpglelggvlltaaealgldflgk
00359891   1/1  elggllsldalggrvvvigggviglelaralleaaeelpgveillgtevteilgdgdg..vtvttgrvtg
00491501   1/1  lvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlllgllllgkrvvviGggaiglel
00484941   1/1  lglgalpdspealgleefpgrvvvigggyiglelagkrvrvggakvtllqrrppfvlpllllglllllll
00462701   1/1  llgglvvvigggviglela...................ralaeaaeel.gveillgtrvteilvdeggrv
00492221   1/1  gvvdpaellralaealaeel.gveirlgtevtdilrdggrvtgvttedllvdkngvevtdgdggtirada
00471331   1/1  llkallealekl.gv.illgt..veil.gddggv.gvtledGeeetieadlvvlAtGglsrvrlll....
00465791   1/1  gggdiglllelaealrrlgvpvellspeelkellplldfpeflgglytprggtvdpaelvralleaaeel
00460571   1/1  gap.prlldapelrellpvvvpgggvvdpaallealaeaaeel.Gveirlg.rvtsi.............
00470221   1/1  ledleelradavvlAtGsrprlppipgedlggvlhsallldllgkrvvvigggasgldlaellarlgaev
00406021   1/1  .lgveiltgtevtei....dg.vvgvvledGeeltieadlvvlatGarsnlrlllgldlpkelleglgl.
00458811   1/1  lsaingvvlergsaedydalipatgaedflgglflpaegilgatgsepfllpgvsllrvldsagalslaf
00400351   1/1  dydfllpgvhsaedalgldllgkrvvviGggysgvelaealarlgapvtlldrsplarlppglls.....
00464461   1/1  llggrvvvigggviglela.........................ralaeaaeel.gveillgtrvteilv
00435771   1/1  gllleadavilAtGarprlppipgldlkgvltsrdlldllgkrvvviGgGasgldiaealarlgaevtvv
00363001   1/1  l.gvevrlgtevtsidrdgdg....vtledge.tleadavvlAtGarprvlll.................
00465141   1/1  l.gveillgtrvtei....dggvvgvttedg.etieadavvlAtGarslllllgrrpntellglegagle
00533211   1/1  ealee.lgveirlgt.vtei....dggvvgvtledGeeetleadlvvlatG..svvrlllg.........
00440981   1/1  l.gveillgtevtsidldgg....gvvltdge.tieadavvlAtGarprllglpgldlpggl........
00487711   1/1  ldaaelraleplldlpdll........gglyvpdggvvdpaalaaalaraaeal.Gveirlgtevtgier
00376431   1/1  l.gvevllgtevtsidrdgggvtgvllvttgdgetiradavvlAtGarpntplleglgle..lderggiv
00486071   1/1  aealekl.gveirlgtalfvdpnrVts.........vtvttedGetgelvpgetiradavvlAtGarprv
00458701   1/1  adalilatgalprlppipgldlgevlhsagyeellrrlgldllgkrvvvigggasavelaalaragasvt
00529631   1/1  rkelldyladlaekl.gveirlnteVtsverdgdgvtvttedgepdgeeetleadaVvlAtGalsrprll
00406881   1/1  l.gveillgtavve....dggrvtl....dge.tieadlvvlAtGarsllll..................
00457971   1/1  eklg.veillgtevtdidlddd..vvvvltdgetitltadavvlAtGsrprllpipgldlegvltsptsi
00475641   1/1  elaeklgveillgtavtellkddggvvv....tgdgetiradavilAtGarsrvppipgldgpgvltsdt
00523131   1/1  l.gveirlgtevtdllleggrvtgVr..tadGe.tlradavvlAtGafsrlllllglelpvgptlgyalv
00364591   1/1  ........................gipggv..lpeelvealaellekl.gveirlgtrvt......dg..
00483561   1/1  ......gggllgvdelaellpllgsevtgglrsprggtvdparlvralaeaaeel.Gveillgtevtsie
00485831   1/1  llaagvegllillgvevvvgvadgggvtvvtgdg.etiradavilAtGarsrvppipgldlpgvltsrta
00457951   1/1  krvavlgggellladgvtgglrpdggrvdparlvrallealeel.Gveillg.evteierdg........
00529111   1/1  elgipfdpe............................gpgggtvdgaa..lvralaeaaleelgveirlg
00472701   1/1  gpelaeylrellekl.gveillgtrvtsidrdgdtgrvtgvtledg.etleadavvlAtGars.......
00499901   1/1  lsllprlpdipgldlfsleellsalglldllgkrvvvigggasgvdlaellarlgarvtllerldgll.l
00400491   1/1  pgsdlpgvllalgkrvvvvgggviglelaaalaealealpgveillgtevtellgdggrvtgvvledget
00368891   1/1  l.gvevllgtevtaidvdgdgvtvtllldgdgetleadlvvlA---------------------------
00488071   1/1  ....................ipgkvdpaellealaelaeel.gveirlgtrv.........---------
00470291   1/1  ssinggvylrgskndfdlwaglaglegwsydellpyfkkaekliiatgsrpllpdlpgglllggdgilts
00455181   1/1  aaalaeaaeel.gveillgtrvt.i....dggvvgvtt.dge.tiradavilAtGalslplll.......
00380741   1/1  laaalaelleel.gvevllgtavt.i...ddgrVtl....dge.titadavilAtGarprll........
00471411   1/1  kl.gveirlgtev.......dg..vtvttedg.etieadavvlAtGalrprllpipgldlpgvlgvhsll
00509271   1/1  llekl.gveillgtevtsidld.ggtvvgvttgdg.etltad..vlAtGarprllllllvpgipgfdgkg
00396641   1/1  aldlkgglvavigggsiarelalaeaalk.lgveilegtevtellgdgdgkgrvtgvvtkdlktgevgti
00424461   1/1  pgrvlpkellealaealekl.gveillgtevtsidrdgggvtv....-----------------------
00462741   1/1  asfldagkwevltedgwgifeeeltadaviiatGarpripdlipglgggvlts-----------------
00488661   1/1  .......eelaaallellekl.gvevllgtrvtaidvdgdgvtvt-------------------------
00480451   1/1  l.gvelllgtrvtaidldggg..vtvtledg.etleadlvvlAtG-------------------------
00406601   1/1  gyaellpfyerleklygvlgegylpdlpgasifkglpvhssfddreldldgkrvvvigsgasavrakavv
00480091   1/1  l.gvelllgtrvtaidvdgdgvtvtledggeeetleadlvvlAtG-------------------------
00533221   1/1  l.gvelllgtrvtaidvdgdgvtvtledggeeetleadlvvlAtG-------------------------
00461281   1/1  dldelakllgvegwgydellpyfkvaedglgltadaiiiatgsrprypgipgplsvswaldldelpk---
00444131   1/1  vvfpdgkvlkvptnlaellksfllglsekrrllaflgviatgdrpralgip-------------------
00476821   1/1  glpedfdal.glgwsyeellpyfkkaekllgvlgalrkllvvigggaiglglalvldrlgakvtgvgrld
00475651   1/1  l.gvelllgtevtaidgdgdgvvvvlllvdvvlgdgetleadl---------------------------
00464161   1/1  leel.gveillgtevt.i...edgrv.gvtledgeeltleadlvilatGrrslPlllpntellgleklgv
00481991   1/1  .....dgeelaaalaelleel.gvevllgtav..ii..ddgtvtv....dge.tieadlvilAtGarprl
00467501   1/1  lkl.gvevllg.evtsidpdg....ktvtledg.etleydllvlAtGarprllpipgldlegvltlrtll
00470681   1/1  lalaelleel.gvevllgtrvtgidpdg....vtvtladge.titadklvlAtGarprllpi--------
00384491   1/1  l.gvevllgtevteveldgggvvvvlgltvevvvlgdgetleadl-------------------------
00488651   1/1  lekl.gvevllgtevtsidgdgkg....vtledg.etleadlvvlatGarpntppipgldllgvldvrga
00467601   1/1  .......daelaaalaellek.lgvevllgt.vteiegddgrvtgvvvvrledge.tleadlvilatGgl
00366541   1/1  l.gvevllgtevtaidvdgdgvtvtvldvvlgdgetleadlvl---------------------------
00509611   1/1  pelskallellekl.gvelllgtevteidgd.......vvlgdg.et-----------------------
00384681   1/1  ........fpafp.........elvellkee.gveillgtavlei-------------------------
00461561   1/1  eirlntevgkd................vtledll..leydavvlAtGalsprllgipgedlpgvvlal--
00472711   1/1  klgveillgtevteidgdgggvtgvtledgldgeeetleadavil-------------------------
00447051   1/1  ........dlllellek.lgveillgtevteiegdgdgftvtlv--------------------------
00485841   1/1  l.gvdlllgtkvtaidrdgdgvtvvlllkdgdgetleadlvllAtG------------------------
00473271   1/1  akalllatgpylpllpglsleevldsllgldllpklvlvigggviglelaellarlgaevtvlergdgll
00483651   1/1  ...............deelalallellekl.gvelllgtevte---------------------------
00496791   1/1  .......pelleyllelleklgveillgtevteiegdgdg.vtgv-------------------------
00482001   1/1  l.gvevllgtevtaiegdgdgvvvvvklvtlgdgetleadlvlia-------------------------
00363011   1/1  kallelleelgvelrlgtevtsidrdg......vvlddgt.tlea-------------------------
00501481   1/1  reqlekl.gveillgtrvtsidl.dggtv...vltdg.etieadavilAtG...................
00479091   1/1  pelallllelle.klgvevllgtrvteiakeylpelllgveveagdgvvtvvlgdgeti-----------
00509601   1/1  ekl.gvevllgtevtsidgdgkg....vtlddge..leadavvlatGsrpntpllpglelderggilvde
00469721   1/1  l.gvelllgtevtaidldgdg.vtvvtledg.etleadlvllAtG-------------------------
00455191   1/1  l.gvevllgtevteidg.............dgetleadavliAtGarpntlllglenggivvde------
00467611   1/1  lekl.gvdvllgtevtaidvddkt.vtvvtledg.etleadlvliA------------------------
00480161   1/1  vvdrlvdlledlgvefvlnvev..........gvdvtldellleydavvlAtGatkprllgipgldldgv
00533831   1/1  ........................alkvdtddeealldaDlvila-------------------------
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  ekl.gvelllgtevtsidlegktvtllllvlgdgetleydklvlAtGarp....................
00469731   1/1  klgvdlllgtkvtaidrdddg.vlvvvledg.etleadlvllAtG-------------------------
00419401   1/1  ...........deelsllleelleelgidvllgtevteiekdg---------------------------
00406191   1/1  dlplrrlleellayllevadaeelg.....................------------------------
00503641   1/1  tleadavvlatGasvprlpdipgldlfggllahsflrrkirelvk-------------------------
00481081   1/1  .......................lpglldeelaelllelleklgvel-----------------------
00529641   1/1  ..................lgvvillnteveevtgdg......v---------------------------
00454811   1/1  ----------------------------------------------------------------------
00382851   1/1  .....................elleelgvelllgtkvtsiegd---------------------------
00463441   1/1  leelgveillgvavteilgdgvel.......geeleleaDlvvlatgftpndel...dealrtsvpgvfa
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  ldlllelpdlll...llallaeeegvefrfgvspveilgdddlgr-------------------------
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  llelleklgvevllgtkvtsidrgedgvvv.vtledget.lea---------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
00477121   1/1  ......................................................................
00468341   1/1  lrklledgddgrvtvttedldtgGeeetiradlvvlAtGarsllrkllglelpgggv.............
00529261   1/1  meplkdGeekpvpveG.etiradlvvlAtGarssprlllleglgle.dgrgyi.................
00374411   1/1  ilgaevtllersdrllallddegqvdprglldalaealeellgveirlgtrvteierdgggvtvtledgd
00503631   1/1  ggvtlsavw........................sdgalallgllvdllpkrvvviGgGsglelasalarl
00413411   1/1  tkdGeevtiradavvlatGafsnlrlllg...lglgltgdglalalrlgaplpdggflqfhPt.......
00526001   1/1  pigvefaealarlgakvtlvergglllpgdgvgdraslaralleaaea.lgveiltgtrvteilrdedgg
00490031   1/1  vvledadGeevtiradavvlatGgfpnlrrllgldlpllpvrgtalalgatgdglalleragvelddrgf
00520321   1/1  dggrvtgVtvrdtadGeeetiradlvvlatGarsnvrl.lglsglglpgdgyalairvgeplpdhl....
00360921   1/1  rvvvigggasgvelasalarlgagvtvvyrpdgg.rgalaralaraaea.agvtvltgtrvteierdggg
00359891   1/1  vvlrdladGeevtiradlvvlatGarsnllllllsgigptgdglalleraglelvde.............
00491501   1/1  alalarlgaevtlversprlgpvlpaglsealaealeallGveirlgtrvteierdgggvtvttedGdge
00484941   1/1  llglspdhligagplrggcdyrgggvfgcpggaglvlggrgslaeallealeelpGveirlgteVteieg
00462701   1/1  tgvtlrdadGeevtiradavvlatGglsnlrlllglglP.........i........fP.dgrlllgpr.
00492221   1/1  vvlAtGarprllelpgldlpgvpdalgil...vleglplvlpenlqgkrvvvigggasglelalylrrlg
00471331   1/1  .....................................................................v
00465791   1/1  .Gveillgtevtsierdgdg--------------------------------------------------
00460571   1/1  .dG.etleadlvvlatGags..rellg.dlglepvrggfivvdpp.............dpeilrrwvglr
00470221   1/1  tvvlerrdrl..llffppdgqvdpag.......lvralaealeallgveirlgtrvteierdggg.vt.V
00406021   1/1  ......................................................................
00458811   1/1  rgkrvvvrltyddnyfndeyqglpereklltlviiGgGndpgklaralaealekrlGveirlgtevteie
00400351   1/1  ..........pgdglldggdgalvaalaealer.lgveillgtrvteilrdgggvtgVttedgeleldge
00464461   1/1  deggrvtgvttedadGeeltiradavvlatGgfpnlalllglglp.......p..........hP.dgrl
00435771   1/1  errprllalldalalllgllsldalaalepllalellggllypdggpaalvealaealegveillgtrvt
00363001   1/1  ..............................................................pglelleg
00465141   1/1  lderggivvdetl.........................................................
00533211   1/1  ..............................................................vrpnlegl
00440981   1/1  ...................................................................eal
00487711   1/1  dg.grvtgVrtadGe..ieadlvvlAaGawsnellellglelpp..........................
00376431   1/1  vdetlrtsvp............................................................
00486071   1/1  ppipGldlpgvltagvlllegl------------------------------------------------
00458701   1/1  lllrsprlglltprggygalvealakalendylealarlgveirlgtrvteilrdgggvt..vttadGe.
00529631   1/1  gllpdipgldlfggrvlhsalyldn.............................................
00406881   1/1  .......................................................grrpntellllelag
00457971   1/1  ldalalllellpgklv.viggGai.............................vllaigrrpntellgle
00475641   1/1  a---------------------------------------------------------------------
00523131   1/1  t---------------------------------------------------------------------
00364591   1/1  vgvtt-----------------------------------------------------------------
00483561   1/1  rdgg..vvgVttedGe..iradlvvlAtGawspellkllgielplgllpvrgqilvv-------------
00485831   1/1  l---------------------------------------------------------------------
00457951   1/1  ..dGe....adlvvlAtGarsplllkl.....pllpvrgqilvleplat..dlpgvfvigdp--------
00529111   1/1  teVtdilvdgggvlwtvrvtGVvvndtgvaldgllkl---------------------------------
00472701   1/1  ......................................................................
00499901   1/1  pgdgvldpkgglgallealleelgveillgtpvtei...............Ge..leadavvlatgldp.
00400491   1/1  geevtiradavvlatGgrpnlellltnppgntgdglalleraglelhdtrggivvdetlrtsvp......
00368891   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00470291   1/1  elalsldllpklvvvigggaiglelapvlarlgakvtgvgrlprglpvgdgglsalvaalakaler.lgv
00455181   1/1  ..................................................................glsp
00380741   1/1  ...................................................................glp
00471411   1/1  ..............savllgllllgkrv------------------------------------------
00509271   1/1  vhtartlldld............................llgkrvvviGggaiglelal..........i
00396641   1/1  radavvlatGgagnlllllsvlepdlrttnpptntgdglalalraglelaglelfvqfhptglitepvrg
00424461   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00406601   1/1  iatGarera-------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00476821   1/1  rglptggrgslakallraaerlGveiltnteVtrilrde-------------------------------
00475651   1/1  ----------------------------------------------------------------------
00464161   1/1  elder.................................................................
00481991   1/1  pplpg.................................................................
00467501   1/1  dalalreal-------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00488651   1/1  i---------------------------------------------------------------------
00467601   1/1  sllll.................................................................
00366541   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  gggdgqiypr------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00501481   1/1  ........................................................vlvaigrrpntell
00479091   1/1  ----------------------------------------------------------------------
00509601   1/1  tl--------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00480161   1/1  ysal------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  ......................................................................
00469731   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00463441   1/1  iGD-------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
00477121   1/1  ..................prtsvgrvflaGDaahavhplggqGlnlAiedarllaealaaalrg.alpaa
00468341   1/1  ......................................................................
00529261   1/1  ...............................................................pvdlpll
00374411   1/1  geeetieadlvvlatGars.ltellgl............................---------------
00503631   1/1  gakvtlverrprllprldpelvepllealeklgvevllnlkvt...........----------------
00413411   1/1  ...............................................hytmggivvdpdlrtsvpglyaa
00526001   1/1  rvtgVetrdladGeeftiradlVvlaaGaipsprllllsGigl...........pevgrilvdhp-----
00490031   1/1  vqffPtll.....................................................---------
00520321   1/1  ..............................................................pggivvde
00360921   1/1  grvtgVtledgegltgeevtiradlvvlaaGarsttrllllsglgl..............----------
00359891   1/1  ......................................................................
00491501   1/1  eetieadavvlatGarpllrlledlg...................................---------
00484941   1/1  dggg.vt.VttedGee.ieadlVilatGarsslr................lledsglppde---------
00462701   1/1  ...........pd.........................delrellpglgvaldehywaggi---------
00492221   1/1  a..k------------------------------------------------------------------
00471331   1/1  rpntellglealgleldierggilvdetlrtsvpgvfaaGdavhgapplavvAlaeGrla----------
00465791   1/1  ----------------------------------------------------------------------
00460571   1/1  pltpd.................................................glplrtp---------
00470221   1/1  ttadGe.tieadlvvlatGarsllrllglpglgleldpagerlpdgWgggipvdpdlrtgv.........
00406021   1/1  ...eldtrggivvdetlrtsvpglyaaGdaag...p..gqgvatalasGrlaaeaiagylkgl-------
00458811   1/1  rdeggrvtvttedgetkdvlgeeeeieadlvvlaaGa---------------------------------
00400351   1/1  evtiradavvlatGarssprllllsgigpaellkalgielpl................dlpgvgen----
00464461   1/1  lfg.prd................................d....dellrll..pglgva-----------
00435771   1/1  eierdgggvtvttedadgslkpvledgetieadavvlatGarslarllldpplppv--------------
00363001   1/1  agleld.ggivvdeylrtsvpgvyaaGdvagvplpllglggggglaavAllsgrvaaenllg--------
00465141   1/1  .........................rtsvpglyaaGdaag.....ggglvatAiasGrlaaeaia-----
00533211   1/1  lleglglelderggivvd.etlrt.svpgvyaaGdaaggp.klavvAlasGrvaaeniagl...------
00440981   1/1  glelderggivvdetlrtsvpglyaaGdvaggpgplavtAlasGrlaalniagyl---------------
00487711   1/1  ...............pdglpvigpvtg...........................................
00376431   1/1  ......................glyaaGdaaggvnplagvAlasGrlaalniagy---------------
00486071   1/1  ----------------------------------------------------------------------
00458701   1/1  tieadavvlatgarplaellgllgpe...................lpergiiavdglpvgsllk------
00529631   1/1  ......................................ldllplykhlfppkgkrvvviGggasgldp..
00406881   1/1  leld...rggivvdetlrtsvpgvyaaGdaag.....ggrgaavAiasGrlaaeaiagyle---------
00457971   1/1  gagleld.rggivvd.etlrts.vpgiyaaGdvag.....gpklavvAlaeGrvaaeniag---------
00475641   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00472701   1/1  .....npnilglegagl.lderggivvdetlrtsvpgvfaaGdvaggplglavvAiaeGrvaa-------
00499901   1/1  laellglelpergl........................................................
00400491   1/1  .................................................................-----
00368891   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00470291   1/1  eiltntrvtrilvdggggglrvtgVetedgggeektiradkeVilaaGaigsprllllsgiglk------
00455181   1/1  ntpgllleglgielderggivvdenlrtsvpglyaaGdvag.....ggngvavaiasGrla---------
00380741   1/1  gitptllleaagvelderggivvdetlrtsvpglyaaGdvagg.grlavvAvaeGr--------------
00471411   1/1  ----------------------------------------------------------------------
00509271   1/1  gvrpntegllledaglelderggilvde.tlrts.vpglyaaGdvaggp.glaavAlaqGrvaaeni---
00396641   1/1  .....................................................................g
00424461   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00464161   1/1  .................ggilvdetlrtsvpglyaaGdvag.....ggrlavvaiaeGrlaal-------
00481991   1/1  .....grrpnte...lleaaglelderggivvdetlrtsvpgiyaaGDvagg.....pklv---------
00467501   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00467601   1/1  ........lgrrpntellgleaaglelderggivvdetlrtsvpgiyaaGDvagg.....prla------
00366541   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00501481   1/1  kl....glelderggivvdelllrtsvpgvfaaGdvaggplr....lavvAvaeGriaalai--------
00479091   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  ......................................................................
00469731   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YEIERSQAADDNIRHSTRSTDFIAPHSKQERRLRDVALALARDVEFAKRMVNAGRLSTPTAYDTPLSTPD
00477121   1/1  ldayererrpraaavlalsrallrlfslddpllrllrdlglrlllllpplkrllarlllglllllpl---
00468341   1/1  ..........rtsvpdgvflaGDaahtvhplggqGanlaledarvlaealaaalkgkdlpalld------
00529261   1/1  ertsvpgvfaaGDaahgvhplggqGinlaledgrvaaeaiagalkgg...--------------------
00374411   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00413411   1/1  Gdaag-----------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00520321   1/1  tlrtsvpglyaaGdaaggsg--------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00359891   1/1  ..rgg-----------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00470221   1/1  ..................................------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00487711   1/1  ...vp-----------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00529631   1/1  ....plaeldaralarlgakvtllprrdellpa-------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00499901   1/1  ..--------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00396641   1/1  ivvdeng---------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00481991   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  ......................................................................
00469731   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ADAWSAGPKPGAALLDAPLQAADGGPVFLTDAFKAAGCGFVLLEIANGAAAPAPQGVRSLRIGKDAPLRD
00477121   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00481991   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  ...vvvaigvtpntgllkaglelderggivvdetlrtsvpgiyAaGDvagvpgl----------------
00469731   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EEGLFTKRYDATPGAAYLLRPDGYVAARFRHPTQAALDAALARASGRAGR--------------------
00477121   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00481991   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------