[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38261.1


[Show Plain Result]

## Summary of Sequence Search
   1::781
 132::777 8.6e-215 41.4% 0046775 00467751 1/1   denum cofactor-binding domain           
 163::781   1e-193 44.5% 0043860 00438601 1/1   denum cofactor-binding domain           
 142::779 4.9e-193 41.7% 0037702 00377021 1/1   denum cofactor-binding domain           
 140::779 2.4e-190 43.0% 0039729 00397291 1/1   denum cofactor-binding domain           
 122::776 3.5e-190 39.2% 0048288 00482881 1/1   denum cofactor-binding domain           
 143::779 2.2e-189 40.2% 0049206 00492061 1/1   denum cofactor-binding domain           
 143::778 3.1e-175 39.5% 0046330 00463301 1/1   denum cofactor-binding domain           
 138::779 7.9e-175 40.8% 0044866 00448662 2/2   denum cofactor-binding domain           
   3::163  2.9e-51 47.1% 0043859 00438591 1/1   hydrogenase molybdoprotein N-domain-lik 
   6::141  7.6e-43 51.2% 0046832 00468321 1/1   hydrogenase molybdoprotein N-domain-lik 
   5::145  8.9e-40 52.3% 0037562 00375621 1/1   hydrogenase molybdoprotein N-domain-lik 
   4::142  1.1e-38 49.6% 0049205 00492051 1/1   hydrogenase molybdoprotein N-domain-lik 
   5::139  4.3e-37 49.6% 0039728 00397281 1/1   hydrogenase molybdoprotein N-domain-lik 
   3::142  3.2e-35 48.8% 0041226 00412261 1/1   hydrogenase molybdoprotein N-domain-lik 
  21::142  3.7e-34 51.3% 0036416 00364161 1/1   hydrogenase molybdoprotein N-domain-lik 
  21::142    3e-33 51.3% 0044865 00448651 1/1   hydrogenase molybdoprotein N-domain-lik 
  19::55        21 18.9% 0044866 00448661 1/2   denum cofactor-binding domain           
   1::781


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
00467751   1/1  ----------------------------------------------------------------------
00438601   1/1  ----------------------------------------------------------------------
00377021   1/1  ----------------------------------------------------------------------
00397291   1/1  ----------------------------------------------------------------------
00482881   1/1  ----------------------------------------------------------------------
00492061   1/1  ----------------------------------------------------------------------
00463301   1/1  ----------------------------------------------------------------------
00448662   2/2  ----------------------------------------------------------------------
00438591   1/1  --gelllellkkldpvGksvlrleglrlvtGearYvdDlplpgllyaalvrspvahArIlsIdtseAlal
00468321   1/1  -----llglalasaleelallllrllllgelvlktpselklvgkpvprldallkvtGeaiYvdDipllpg
00375621   1/1  ----qllelldelslvGkpvkrveglrlvtGearYvdDiplpgllyaafvrspvahAriksidlsealal
00492051   1/1  ---klvGkpvprvdalakvtGeavYvdDiplpgmlyaavvrspvaharilsidlsaalalpGvvavltak
00397281   1/1  ----lvGkpvprvdalakvtGeavYvdDipllpgllyaalvrspvaharilsidlsaalalpgvvavlta
00412261   1/1  --lrlvGkpvprvdalakvtGeavYvdDiplpgmlyaavvrspvaharilsidlsaalalpGvvavltak
00364161   1/1  --------------------GearYvdDiplpgllyaalvrspvaharilsidlsaalalpGVvavltak
00448651   1/1  --------------------GearYvdDiplpgllyaavvrspvaharilsidlsaalalpGVvavltak
00448661   1/2  ------------------akGvgepgldgvapaianAvfdatgvrvrrlPltpek---------------


                         -         -         *         -         -         -         -:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDAAEAVVVEYEELP
00467751   1/1  -------------------------------------------------------------vkveyeelp
00438601   1/1  ----------------------------------------------------------------------
00377021   1/1  ----------------------------------------------------------------------
00397291   1/1  ---------------------------------------------------------------------P
00482881   1/1  ---------------------------------------------------ldaeeAlkadapvvyedlp
00492061   1/1  ----------------------------------------------------------------------
00463301   1/1  ----------------------------------------------------------------------
00448662   2/2  -------------------------------------------------------------------elp
00438591   1/1  pgvlavltakdlpglnllllllg......dsspllspvepvladgkvryvgqpvAvvvAetlelAedaae
00468321   1/1  mlyaavvrspvahAriksidtsealalpGVvavltakdipglnllglll...............deplla
00375621   1/1  pGVlavltakdlpglnlllllllllld...........epvladdkvryvGqpvavVvAetrelAedaae
00492051   1/1  dlpglnllgpllld..............eplladdevryvGqpvaaVvAetleaardaaelvkveyeelp
00397281   1/1  kdlp....glnllgpllld..........eplladdkvryvGqpvaaVvAetleaardaaelvkveyee-
00412261   1/1  dlpglnallllllllld...........epvladdkvryvGqpvaaVvAetleaArdaaelvkveYeelp
00364161   1/1  d.....lpglnllllllllllsllllldlplladdkvryvGqpvaaVvAetleaArdaaelvkveYeelp
00448651   1/1  dlpglnllllllll.....llsplvlldlplladdkvryvGqpvaaVvAetleaArdaaelvkveYeelp
00448661   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AVADIKAAIAPGAAQLHPEAPGNIVYDWEIGDQKAVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
00467751   1/1  avldleealaadapllhed..pnnvlllllldrgdveaafaeadvvveaeyttprqahaplEpraalavp
00438601   1/1  ----------------------vselllelGd...veaalaeaavvveaeytlpylahaplEplnavalp
00377021   1/1  -vldiedaleagapllhel.......vlergd...veaafaeadvvveaeytlprqahaplEpqaalavp
00397291   1/1  avldieealeagaplvhdelllnr......Gd...veaafaeadvvveaeytlprqahaplEpqaalAvp
00482881   1/1  avldleeale.........apsnvvldlerGdeaaveaafaeadvvveaeyttprlahaplEpqaalAvp
00492061   1/1  --ldieeAlapdapllheelpsnvllelllerGd...veaafaeadvvveaeyrtprqahaplEpqaala
00463301   1/1  --ldieeAlkadapllvel.ddnvladlllerGd...veaalafaeadvvveaeyttprqahaplEpqaa
00448662   2/2  avldaeealk.....vdwelgpnills.vllergdveaafaeadvvveatytlprqahaplEpqaalavp
00438591   1/1  lvkveYeelpavvdieealeega-----------------------------------------------
00468321   1/1  d---------------------------------------------------------------------
00375621   1/1  lvkve-----------------------------------------------------------------
00492051   1/1  av--------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  av--------------------------------------------------------------------
00364161   1/1  av--------------------------------------------------------------------
00448651   1/1  av--------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
00467751   1/1  daedgrltvwsstQgphlvrralakvlgl.peekvrvivprvGGgFGgKlslypeavlaalaarklgrPV
00438601   1/1  daedgrlevwsstQaptlvraavAaalglpe.dkvrvivprvGGgFGrklspdlvavlaalaalalgrPV
00377021   1/1  dgedgrltvwsstQaphlvralvakvlgl.peekvrvivprvGGgFGgKlslypelavlaalaAkalgrP
00397291   1/1  d..dgrltvwsstQgphlvralvakvlgl.peekvrvivprvGGgFGgKlslypelavlaalaAralgrP
00482881   1/1  deadgrltvwsstQaphlvraavakvlgl.peekvrvivprvGGgFGgKlslsdeavlaalaAkalgrPV
00492061   1/1  vpdeadgrltvwsstQaphlvraalakalgl.peekvrvivprvGGgFGgKlsllllavlaalaAlalgr
00463301   1/1  lavpde.dgrltvwsstQgphlvraavakalglpeeekvrvivprvGGgFGgKlsllla.vlaalaAlal
00448662   2/2  dg.dgrltvwsstQaphlvralvakvlgl.peekvrvivprvGGgFGgklsllpa.vlaalaAkalgrPV
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
00467751   1/1  klvldReedflatgkrhpflirvklgadkdGkilaldvdlladtgayadlsgavllllralgladgpYdi
00438601   1/1  rlvlsreedllaggkrpavlikvragldadgkilaldvevvadsgaylnlsptvalvavlalglalglYd
00377021   1/1  VklvlsReedflatgkrhpflirvklgldadGkilaldvelladagayldls..gpvlelaaglldgpYd
00397291   1/1  VklvlsReedflatgkrhpflirvklgadadGkilaldvelladagayldlsep..vlllaagladgpYd
00482881   1/1  klvltReedmlatgkrpaflirvrlgldadGkllaldvelladsgayssdlspgvllravlgladgpYdi
00492061   1/1  PVklvltReedflatgkrhpflirvklgadkdGkllaldvdlladtgayadls..plvlllaalladgpY
00463301   1/1  grPVklvltReedflatgkrhpflirvklgadkdGkllaldvdlladagayadls..glvlelaalladg
00448662   2/2  klvltReedflatgkrhatlirvklgldadGkilaldvelladagayldlsgp..vlelaagladgpYdi
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
00467751   1/1  pnvrvdgraelvytntvpvgayRgfgrpqaafaiEslidelArklglDplelRlrnlikpgdlpyttplg
00438601   1/1  ipnvrieavavltnkvpvgayRgvgapeaafalEslidelArelglDPlefRlrnlidegafpyktplgl
00377021   1/1  ipnvrvegravltnlvpvgafRgvgapqaafalEslidelArelgldplelRlrnlide.gyltptglpy
00397291   1/1  ipnvrvegravytntvpvgafRgvgapqgafalEslidelArelgldplelRlrnlidpgdltllgllll
00482881   1/1  pnvrvdgravytntvpvgaayRgvgalpqgafalEsfmdelArelgldPlelRlrnlldpgdlpyttptg
00492061   1/1  dipnvrvdgravytntvpvgafRgfgapqgafalEslmdelAralgldplelRlrnlirpgplttplglp
00463301   1/1  pYdipnvrvegravytntvpvgafRgfgapqgafalEslmdelAralgldplelRlrnlirp.gdltptg
00448662   2/2  pnvrvegravltnlvpvgafRgvgapqaafalEslidelArelgldplelRlrnlidp.pyltplglpyd
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IGDFGASLDAALKAADYSGFAARKAKAKAEGKLRGLGFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
00467751   1/1  lpydsgdlaevlekaaelsgwdkrraekieefnaggklrgrGiAlapekfgigpglllllllltllnqag
00438601   1/1  pydsgrlrevleaaaeaagwggrraavaeanaggklrgiGvAlaieavgigps.avgslilglglfesAl
00377021   1/1  dsgrlrevlelaaelagwgerraavaefnaggrlrgrGiAlapevfgigp.......gaglllqagalvr
00397291   1/1  gsllselllpyttplglpydsgrlrevlelaaelagwderraavrefnaggrlrgrGiAlapekfgigf.
00482881   1/1  lpydsgrlrevlelaaelagwgerlaegrgrgvanrrgfllkrlGigvAlvvevsglgvsrvvaald..a
00492061   1/1  ydsgrlaevlelaaelagwder......lnaggrlrgrGiAlapekfgigftll.....llllnqagalv
00463301   1/1  lpldsgrlrevlelaaelagwder..rpfnarnggklrGiGlalavegiglgp...........lnqaga
00448662   2/2  sgrlrevlelaaelagwakrr..pfnarnrgrlrGigvalavegvglap...........llqagalvri
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFKA
00467751   1/1  alvrlypdGsvtvltggteiGqGletvlaqiaaeeLgiplekvrvvlgdtdkvpngggtggSrstalvgs
00438601   1/1  vrinpdGsvtvltgaieiGqGhettlaqivaeeLgipldditvvlgdtdt.pfgmgtygSrstavvgsAv
00377021   1/1  iypdGsvtvlvggtemGqGletalaqivaeeLgvpldrvrvvlgdtdlvpngggtggSrstavsgsavrk
00397291   1/1  ......llglllqagalvrlypdGsvlvlvggteiGqGletvlaqivaeeLgipldrvrvvlgdTdlvpn
00482881   1/1  glvvnalvriqpdGsvtvglgaaemGqGlvtalaqiaaeeLgidldkvevvlgdtdlvpggvgtggsrsa
00492061   1/1  rlypdGsvlvlvggtemGqGletvlaqiaaeaLgiplervrvvlgdTdlvpngggtggSrstavvgsAvl
00463301   1/1  lvrlyadGsvlvlvggteiGqGletvalalaqiaaeeLgiplervrvvlgdtdlvpngggtggSrstalv
00448662   2/2  npdGsvtvlvggtemGqGletalaqivaeaaeeLgvpldrvrvvlgdtdtvpngggtggSrstavsgsav
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           MEKVEAKAKKIAAHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
00467751   1/1  avllAaeklrerllkiaakllgvsaedlefedgrvvvkgdplslallallaalaa.lglyltpelgldae
00438601   1/1  rkAaeklrekllkiaaelleaseedleledgkllvagatdksvslaelalaayvagvlliasleagledk
00377021   1/1  Aaaalrerlleaaakllgvpaedlvledgvvrvkgsgrslslgela...............glaatlgvg
00397291   1/1  gsgtggSrstavvgsAvllAaeklrerllkiaakllgvsaedleledglvvv..gdksvslaelalaayl
00482881   1/1  pavgnavraAgarlrelllaaaakllgvdaedleledgvvvvkgdggrslslaelaalaal..glyagpe
00492061   1/1  lAaeklrerllalaakllgvdaedleledglvvvkgsgdrslslaelaaaaylagvslsatgfyklpdll
00463301   1/1  gsAvllAaeklrerllklaakllgvsaedlvladglvvvagtp......................elgld
00448662   2/2  rkAaaklrerllkaaakllgvp..dleaedgvvvvagggrslslgelaaaay..................
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
00467751   1/1  tglgvpfsyfaygahvaeVevdpltgevrvlrvvavvDvGrvinPllvegQieGGivqGlGlallEelvy
00438601   1/1  alygppnstfsygAhvaeVevdpetgevrvlrvvaavDvGrvvnPlivegQieGgivqGlglalleelvy
00377021   1/1  dpfsyfsygahvaeVevdpltgevrvlrvvavvDvGrvinPalvegQieGgivqGlglallEelvydedG
00397291   1/1  .......levglsatgfykppdlgldletgkgkpfsyysygahvaeVevDtltgevrvlrvvavvDvGrv
00482881   1/1  lpldaevglgdpfayylygahvaevevdkltGevrvlrvdavldvGrvlnpalvegqieGgvvqGiglal
00492061   1/1  ldlldaeallglpfsyysygahvaeVevdtltgevrvlrvvavvDvGrvinPalvegQieGGvvqGlgla
00463301   1/1  alalagdpfsyysygaavaeVevdtltgevrvlrvvavvDvGrvinPalvegQieGgvvqGlGlallEel
00448662   2/2  agpppsyfsygahvaeVevdpltgevrvlrvvavvDvGrvlnPllvegQieGgivqGlglalleelvyde
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LVTASFMDYAMPRADDVPSFKVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATP
00467751   1/1  dedGrlltsnfadYkipraadvPeievvilespdplgplgakGvGEpglipvapAianAiadatgvrlrd
00438601   1/1  dddgrlltsnfadYkipraadvPeievellespdppgplgakGvGEpgvipvapAlanAifdatrdaGvr
00377021   1/1  rlltsnladYkiptaadvPeievvlllsetppplgplgakGvGEpglilvaavlfAianAvadalkdlse
00397291   1/1  inPalvegQieGgivqGlglallEelvydedGrlltsnladYkiptaadvPdievllldlespsppgplg
00482881   1/1  lEelvydedGrlltasladYkiPtaadvPdievilletpdplgplgaKGvGElgligvaaAianAvadal
00492061   1/1  llEelvyde.grlltsnladYkipraadvPeievillespdppgplgaKGvGEpglipvapAianAiada
00463301   1/1  vyddggv....nladYkipraadvPleievillespdppgplgakGvGEpglipvapAianAvadatgvr
00448662   2/2  ggv....nladYkipraldiPkefevillesprpdgplgakGvgepgldgvapaianAvfdatgvrvrrl
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           DRVWHAIHGNA-----------------------------------------------------------
00467751   1/1  lPltpek---------------------------------------------------------------
00438601   1/1  irdlPltpeki-----------------------------------------------------------
00377021   1/1  frligvrir-------------------------------------------------------------
00397291   1/1  aKGvGEpgl-------------------------------------------------------------
00482881   1/1  adtgvr----------------------------------------------------------------
00492061   1/1  tgvrlrdlP-------------------------------------------------------------
00463301   1/1  lrdlPltp--------------------------------------------------------------
00448662   2/2  Pltpekvls-------------------------------------------------------------
00438591   1/1  ----------------------------------------------------------------------
00468321   1/1  ----------------------------------------------------------------------
00375621   1/1  ----------------------------------------------------------------------
00492051   1/1  ----------------------------------------------------------------------
00397281   1/1  ----------------------------------------------------------------------
00412261   1/1  ----------------------------------------------------------------------
00364161   1/1  ----------------------------------------------------------------------
00448651   1/1  ----------------------------------------------------------------------
00448661   1/2  ----------------------------------------------------------------------