[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38351.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
  32::442    2e-44 27.1% 0036899 00368991 1/1   s)glycosidases                          
  33::434  4.8e-39 27.5% 0049716 00497161 1/1   s)glycosidases                          
  33::441    3e-38 27.2% 0046556 00465561 1/1   s)glycosidases                          
  49::434  8.6e-37 28.2% 0047099 00470991 1/1   s)glycosidases                          
  29::379  1.2e-33 26.3% 0053367 00533671 1/1   s)glycosidases                          
   1::440  4.7e-33 23.8% 0046523 00465231 1/1   s)glycosidases                          
  32::379  3.3e-32 26.8% 0046891 00468911 1/1   s)glycosidases                          
  34::421    1e-31 29.9% 0045994 00459941 1/1   s)glycosidases                          
  33::382  1.5e-30 25.8% 0048992 00489921 1/1   s)glycosidases                          
  30::400  1.8e-30 21.6% 0049162 00491621 1/1   s)glycosidases                          
  35::420  1.9e-30 28.8% 0050643 00506431 1/1   s)glycosidases                          
  49::438  1.4e-29 23.2% 0050215 00502151 1/1   s)glycosidases                          
  34::393  8.2e-27 21.9% 0050004 00500041 1/1   s)glycosidases                          
  37::425  2.5e-26 28.6% 0052086 00520861 1/1   s)glycosidases                          
  79::432  4.7e-24 25.2% 0046122 00461221 1/1   s)glycosidases                          
  50::402  3.4e-23 21.7% 0049908 00499081 1/1   s)glycosidases                          
  29::390  1.7e-20 22.8% 0047122 00471221 1/1   s)glycosidases                          
  82::382  5.9e-20 24.3% 0046607 00466071 1/1   s)glycosidases                          
  41::409  5.3e-16 24.3% 0050130 00501301 1/1   s)glycosidases                          
  49::415  6.2e-16 24.3% 0048295 00482951 1/1   s)glycosidases                          
  78::372  1.1e-14 23.2% 0049054 00490541 1/1   s)glycosidases                          
  37::403  1.1e-13 21.5% 0045965 00459651 1/1   s)glycosidases                          
  77::390    2e-13 21.7% 0049977 00499771 1/1   s)glycosidases                          
  42::379  4.1e-13 21.1% 0047190 00471901 1/1   s)glycosidases                          
  46::431    1e-10 21.6% 0038607 00386071 1/1   s)glycosidases                          
  80::364  1.5e-10 24.8% 0049976 00499761 1/1   s)glycosidases                          
 146::379  5.7e-10 21.5% 0046782 00467821 1/1   s)glycosidases                          
  82::378  1.4e-09 22.3% 0048418 00484181 1/1   s)glycosidases                          
  51::379  3.1e-09 21.4% 0050404 00504041 1/1   s)glycosidases                          
  59::379    1e-08 19.5% 0046176 00461761 1/1   s)glycosidases                          
  37::251  9.3e-08 21.5% 0051370 00513701 1/1   s)glycosidases                          
  28::380  3.6e-07 21.5% 0047542 00475421 1/1   s)glycosidases                          
  36::358  1.5e-06 20.1% 0036535 00365351 1/1   s)glycosidases                          
 134::266  1.5e-06 15.3% 0048565 00485651 1/1   s)glycosidases                          
  59::364  1.8e-06 22.7% 0047897 00478971 1/1   s)glycosidases                          
  49::266    3e-06 19.0% 0038605 00386051 1/1   s)glycosidases                          
  76::368  1.4e-05 21.9% 0050167 00501671 1/1   s)glycosidases                          
  72::381  2.1e-05 20.5% 0048402 00484021 1/1   s)glycosidases                          
 124::383  2.1e-05 17.1% 0052173 00521731 1/1   s)glycosidases                          
 123::274  4.5e-05 22.4% 0052061 00520611 1/1   s)glycosidases                          
  49::397  0.00031 21.3% 0037707 00377071 1/1   s)glycosidases                          
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDAAVPSHVADPPAIVRDAGDLRPAGRGGYLLPNGYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAP
00368991   1/1  -------------------------------apagflstsgrgivdlnGkpvklrGvNlggwlvl.eyvp
00497161   1/1  --------------------------------algflsvsgnklvd.ngkpvvlrGvNlggllfae....
00465561   1/1  --------------------------------algflsvsgnklvd.ngkpvvlrGvnlggllfae....
00470991   1/1  ------------------------------------------------GnkvmlrGvNlggalfaeg.ti
00533671   1/1  ----------------------------taaaglgflsvkgnklvdlngkpvylrGvnlggllf......
00465231   1/1  Mkklllllflaglala...................alqveggklvdengrgvnlgg..wf.eawiteslf
00468911   1/1  -------------------------------kllllllllllllagfgplsvkgnkflvdsnGkpvilrG
00459941   1/1  ---------------------------------lgglevsgnklvdlnGkpvllrGvnlgganf......
00489921   1/1  --------------------------------Gfrfvtvdgnkfvl.ngkpfylrGvnyygdg.......
00491621   1/1  -----------------------------aa.f...vevdgrgfvl.nGkpvflrGvnyggsgdvlgdhy
00506431   1/1  ----------------------------------gglsvsggklvdangkpvllrGvNlggwwdtf....
00502151   1/1  ------------------------------------------------n..vflrGvnlhgflvpeg...
00500041   1/1  ---------------------------------egtvevdgggfv.lnGkpvflrGvnihpgsfl.sgeg
00520861   1/1  ------------------------------------fvtsggkifdlnGkpfylrGvNlywlgfetslem
00461221   1/1  ----------------------------------------------------------------------
00499081   1/1  -------------------------------------------------FthkprkllGvnydpagdlyg
00471221   1/1  ----------------------------plivdfdgrkrklrGvNlGgwLvlepwitpslfdgapgndis
00466071   1/1  ----------------------------------------------------------------------
00501301   1/1  ----------------------------------------vglqfl.ldgkpfflfgvaid.........
00482951   1/1  ------------------------------------------------dGkppsllgveihgfrfG.aav
00490541   1/1  ----------------------------------------------------------------------
00459651   1/1  ------------------------------------vevkgggfll.NGkpvflrGvnrhpddpllgra.
00499771   1/1  ----------------------------------------------------------------------
00471901   1/1  -----------------------------------------slavgadgvpvsgadllldgkpfflfGva
00386071   1/1  ---------------------------------------------kafirGvdlsslnteekagvdfind
00499761   1/1  ----------------------------------------------------------------------
00467821   1/1  ----------------------------------------------------------------------
00484181   1/1  ----------------------------------------------------------------------
00504041   1/1  --------------------------------------------------Plehwgrfvgvgg.....hp
00461761   1/1  ----------------------------------------------------------pllngkpflfGv
00513701   1/1  ------------------------------------vevkgggfl.lNGkpvflrGvnyhpddpllgaav
00475421   1/1  ---------------------------kasvtlvdpnatpeikrlygllaellgrailsGiqepvapgad
00365351   1/1  -----------------------------------tveikgggfl.lNGkpfflkGvnyhpddpllg...
00485651   1/1  ----------------------------------------------------------------------
00478971   1/1  ----------------------------------------------------------llGgdyhpahwp
00386051   1/1  ------------------------------------------------alfakGadisvvyevegagvny
00501671   1/1  ----------------------------------------------------------------------
00484021   1/1  ----------------------------------------------------------------------
00521731   1/1  ----------------------------------------------------------------------
00520611   1/1  ----------------------------------------------------------------------
00377071   1/1  ------------------------------------------------kdfllGvdlspyqlegacgvsy


                         -         -         *         -         -         -         -:140
query           SGIWRVSYKTVLDSIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVT
00368991   1/1  egldtnpteddldllkslGfntvRlpifwelleppapdggydi...............ldlnpgvyde.g
00497161   1/1  .wldpfiteedidalkddlGfntvRipvswellvpd.nggvldpdglar.....................
00465561   1/1  glldtytteedldlikdaGfnvvRlpvswevlep...pgtlde...........................
00470991   1/1  pgetgwdypfiteedidllkdlGfnvvRlpitwerllpnggggtlde.......................
00533671   1/1  .lenfytteedikllkdlGlnvvRlpvgwdal...............................pgvlded
00465231   1/1  dglpgetgwgnpfiteedidllkdlGfNtvRipiswerlepdgdgkide.....................
00468911   1/1  vnlggll........wldpfiteedidllkddlGfnvvRlpvyw...d......................
00459941   1/1  .....fateddikllkdlGfntvRvpvyw.................gylldpey................
00489921   1/1  egwdeaiierdlkllkalGlnvvRvpifydallepkeglydls.wlalqpspgpydee............
00491621   1/1  ...dreiieedldllkelGfNavRlphgneiswsriepgpgtyn..........................
00506431   1/1  ......iteddidaiadaGlNvvRipigyeal............................ldetylayld
00502151   1/1  ...dpeiweddldllkelGfNavRlpvswerhepaegggtydpggldd......................
00500041   1/1  aggdyegieedldllkelGfnavRlspiweriepdgggyigdyly.......................pg
00520861   1/1  fghgwdraiidadldllkaaGfntvRvplfnellwdpleg............npglyigldanglqrl..
00461221   1/1  --------ngaflrGvnlggwlgltgdvapghydreiteedldllkelGfnavRlpiswsrieps.....
00499081   1/1  .........ited.ldllkedlGfnavRlpggye....................nsiswsr.eppgpgrp
00471221   1/1  dgdvavdeytlvealgadkaesvleghwdtfiteedfdliasaGlntvRiPvgywaf.............
00466071   1/1  -----------fklikaaGlNtvRipigywafepldggpyne...........................g
00501301   1/1  py.lykedieddl.llkelGfntvtpRisiswsrie............................pdg.ge
00482951   1/1  npeyw....eddlallka.Gfntvtprl.svkwnliep..........................epGvyd
00490541   1/1  -------tidpnilgqtieglgrsiyfglfglgsplydlnglrkdlldllkdlgvnvvRfPGGnfvdgyl
00459651   1/1  ..vseealerdlellkelGlNavRtshypes.......................................
00499771   1/1  ------LllllvlaslaadfirGvnlsgllvleksglkpydddgiteddfkllkeaGfnvVRip...vww
00471901   1/1  ihyyrllyeediadLlkelGlntvRis...........................ikWsriepegGeyn..
00386071   1/1  ngtakd....llqllkdlGfnsvRlrvwvepl...............................dgnyd..
00499761   1/1  ---------GLvdvgkpgflfGgaigplrlddedyteedl.llkelglntvrnpikwsrlep........
00467821   1/1  ----------------------------------------------------------------------
00484181   1/1  -----------GpslkdllngkpflfGvaidpyhlykediedll..lkelGlntvrlsiswsri......
00504041   1/1  lalsygrreedlallkelGfnwvRipillggnfvsyiswsr.iepgpgrynfaw................
00461761   1/1  aihpeqwpgadfyeryeedl.llkelGlntvRfsikWsri.epep.g.f.....................
00513701   1/1  d...eealerdlellkelGlNaiRtshypes.......................................
00475421   1/1  idglrgdvsdvvkalGkppalr..Gadfvsgyawedgggpa....edririlkdggintirlhwnnp...
00365351   1/1  ravdeealrrdlrllkeagiNaiRvwhy...pes....................................
00485651   1/1  ---------------------------------------------------------------idGfGgs
00478971   1/1  yerw....eedlalmkeaGlntvrigi...............faWariepepGqydfs............
00386051   1/1  gdlngi.ieddldllkelGvnavRlyvww.....nppdggyd............................
00501671   1/1  -----lrlkFPkdFlwGvataayqieggwnldgkglsiwdvfthyppevaidfyhrykedialmkelGfn
00484021   1/1  -ldgfgissgigyyniverdlllkelglntvriglswarvepnpggydl.....................
00521731   1/1  -----------------------------------------------------llsGvyldvgadfdald
00520611   1/1  ----------------------------------------------------svtlvdpnatleakalys
00377071   1/1  gdnlg.lyeediallkdlGvnvvRlyiWnrlep...........geydlddlde................


                         +         -         -         -         -         *         -:210
query           TLVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVAR
00368991   1/1  ylarldevvdaakkrGiyvildlhnnpgs....yggad............fwtsptvkdafldfwkalae
00497161   1/1  .....ldevvdaaianglyvildlhnypgyq..........................sldaavdfwkqla
00465561   1/1  ....ayldrldevvdaalkngiyvildlh...dypgyq.......................lldaavdfw
00470991   1/1  ....aylarldavvdaalanglyvildlHhyggggnnsit.....................tldafadfw
00533671   1/1  ylkrldevvdaalkngiyvildlhnapg.......................yddpayldaakdfwkqvat
00465231   1/1  ......agldrldevvdyalkngiyvilDlHhdpgsqngedysgwt..............ndelvdrfad
00468911   1/1  ......dngytidpellarldevvdaalkngiyVildlhhapg........gwnp..............p
00459941   1/1  .larldavvdlakknglyvildlhdapgy............ldgddp........etldafvdfwtqlae
00489921   1/1  glerldrvldladkhGlkvildlhnawgdaggfdqypnwl.....ggrgdlfytdpayrealknyikavv
00491621   1/1  .eeglddldelidladknGiyvildlhpywtapghqdgppawlddyggigfrga.......llwsnpefl
00506431   1/1  ......avvdaaianglyvildlHgapgsqngfd.......................ldaaldfwkqlak
00502151   1/1  .......................ldelvdlakknGiyvildlhgdpgsqnpewlsggypgw.........
00500041   1/1  tyneeglddldelvdaahkrGikvildlvnhtdlpgdqggl..pawlgdalyskdnpyrdwyvwrdgkpg
00520861   1/1  .......drvvdlakkhgikvildlhnlwwdyggpdwy...........gdlfysdpalqsafknywktv
00461221   1/1  ......ggdptydp.................gglddldelidaakkaGiyvildlhwdppswlpddyggg
00499081   1/1  nefgtlayldelldaakknGikvildlhhapgwqnglpqwlpdky........ggwsnpelleafadyve
00471221   1/1  .............epldgdpyvdeggldyldravdwarkyglyvilDlHgapgsqngfdhsglsgsplwl
00466071   1/1  gleyldravewarkyglyvilDlHgapgsqngfdhsgllgaplwln........denldrtldlweqiae
00501301   1/1  yn....ldyldrlvdlakknGikvildtlvwhwdlPgwl..............edggwtnpelldafady
00482951   1/1  ....fedldrlvdlakknGlkvildlhvwhgglPgwll.........gdkgpgllsdpelleafkdyika
00490541   1/1  Wadg.....igpleprpgrynlawg...............gletdllgldelvdlakaaGiepiitlnyg
00459651   1/1  .....defldladelGilvilelplawhgyg...................fptdpefleaflrevremvr
00499771   1/1  dpl.......................epsggpyvvgasdlddldkvvkrAkaaGlkvildlhysdfwadp
00471901   1/1  ..feyldrlidlakknGikvildtlvy....hgglPawlqdkgggslrtdsdgrgwrqntnpelldafad
00386071   1/1  ..ldyldavlkaakaaGlkvildlhys..dtwadpgkql..lpagwan.di....dqlkaavydytkrla
00499761   1/1  .....................epGqyd....fsdldalvdlakknGlkvilhtlhWhgglPgwllgddng
00467821   1/1  -----asgldflangkpflfGvaidpyhlykediadlllkelGlntvRlsiswsriepeggqygldfldr
00484181   1/1  ......................epeg.geyn....ldfldrlvdlakknGikvildtlvwhwdlPgwl..
00504041   1/1  ....ldrlvdallaagleplitlnggpgwaaddlpglleyyggpgpped........ldawadyvaalar
00461761   1/1  ..........nfdfldrlvdlakknGikviltllhwdlpqglpdwl...................ggw.n
00513701   1/1  .....defldladelGilvilelpleghglw............ggsdynlypddpewleaaldelremve
00475421   1/1  ......................................................agalgfdewvdaayse
00365351   1/1  .....defydladelGilvilefplewhgaf...............ggnlypndpefleavldevremve
00485651   1/1  ltdasailllnlseekrdelldllFspdglglnilRvpigasdfslreygydwvrndlewsrfepapggy
00478971   1/1  ...yldraidlareaGlkvildlhhytlPewllggyPdwlpvdqggrlnlsglrghydwls.......pe
00386051   1/1  ..lddldellkaaaklgikvlldlhysd.........twad..Pglqalpngwgslfdelaaalydytld
00501671   1/1  avRfsisWsriepeg..gev............................neeglafydelidelleaGiep
00484021   1/1  ..........ayldplikrakargiklllslwssPgwakpngqllgggwlk..p............elya
00521731   1/1  plgdllgrgvnlvrlflwwdsdldyvieaakrakaaglkllldlhpsdsg....................
00520611   1/1  yLvsilgkgillGqqevslvglswgndageiddvlaltgdypairgvdlirlrvwvnpggflgwrgvdld
00377071   1/1  ........vlkaakaaGlkvlldlhhsdl..........wad..Pawqktpggwlntnidelksafadyv


                         -         -         -         +         -         -         -:280
query           TFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVSPGVLIICEGPETYKPPPASSG
00368991   1/1  rykdnptvigfellNEprg..palwggdldpdtlkayyqeaidaiRavdpnrliivgglgwsg.......
00497161   1/1  trykdnpnvi.fellNEpngv........edwavlknlaqaaidaIRavdpnrliivgg...........
00465561   1/1  kelakrykdnpnvl.fellNEpngn........adwatlkdyaeaaidaiRavdpnhliivggpg.....
00470991   1/1  kqlaerfkdnpnvi.fellNEphgv.........dwalwnsyaqaaidaIRaagpnnrliivggnn....
00533671   1/1  rykdypnvi.fellNEprgg......sdadaellkayaqeaidaiRaidpnhliivggpgwsqdl.....
00465231   1/1  fwkqlaerfkdypnvlgfellNEPnggvllgygwlppglwdgkadadvlldyyqaaidaiRaiggnnpnr
00468911   1/1  enldaavdfwkqiaerykdhpaldvviwellNEprgggnggewlggsgenwedlkeyaeaaidaiRavd.
00459941   1/1  ryknnpnvvifelgNEphg.......gtsvdwalwkayaeaaikaiRaadpnrlilvgg...........
00489921   1/1  eryknhpavlaWelgNEprg.......ggtsadalkawleelaaairsldpnhlvtvgdegfdgnssddg
00491621   1/1  eafadyaralaerinpltglyykdhpsvigwevgNEpng......ggdfdadelaeylraaadairaadp
00506431   1/1  ryknnpnvvifellNEplgg...vdw.....slwkdyyqaaidaiRaagpnnliivgg............
00502151   1/1  .....dnpefleafadyiralaerykdrhpnvigwelgNEpnggggw....tadpdllkdyyraaadair
00500041   1/1  g......wtnpevreafldyarylaeryadlrlknykdgprvdawevgNEpnlg..gwfgggvdaddlae
00520861   1/1  asrykndpavlawdliNEPrgggdssgtnsaalwdgstldnngkllayelygldllknfiqeaiaairea
00461221   1/1  .................lwtnpelleafadyaralaerykdhpnvigwelgNEpnggal.........en
00499081   1/1  avaerykdrnGleepkvigwevgNEp...nggllwgygtadnlldairaaakairaadpdakvgindang
00471221   1/1  nde........nqdrfldlweqiaerykdnpykdtvlgfellNEPlgpgl......adadllndyyqray
00466071   1/1  rykdnpyldavlgfellNEP.......lggvldaellkdfyqraydairaidpnhliivgg.........
00501301   1/1  akavaerykdr..viawevgNEpnlgagsgypstpsdalgkdyleraadairaadpdaplfvgdypfd..
00482951   1/1  laerykgr..viawdvgNEpnlgalwgylrgsgspdalgkdyleaaadairaadpnaplfvndynlaspl
00490541   1/1  pgwvddagdwv.................pyllgafasyvaalarryGkdepynvkyweigNEpnl...pw
00459651   1/1  ryknhPsiiaWslgNEpgg..........gtdallallkelaalikelDptrpvtagsagfggd......
00499771   1/1  gsqngpdawgg.....wdneal......kaafakytkqiaerykdygdnviaievgNEpng...gmlwgl
00471901   1/1  yiravakryggr..vkawevvNEpnl.gaglgygsfdydalgadyleaafkairafadpdaklfigdygf
00386071   1/1  tryknagdlvigwevgNEpllgalwgggggatpdnlaslleaaidavraadpnalikv......avhlas
00499761   1/1  gwl.............sdpelleafkdfiralakryggr..viawdvgNEpl....lgsfsgrdspwddv
00467821   1/1  lvdlakknGikviltlh....hwd.gqlPqwl..........ggwtnpelldafadyakavaerygdr..
00484181   1/1  ..............ggwtnpelvdafadyakavaerygdr..vkawevgNEpnlfallgylrssvdydal
00504041   1/1  rykdrgglepvgvkyweiwNEPdlp...wfwgngtpeeyaelykaaakaikavdPdakvggpgvsgassp
00461761   1/1  pelldafadyaravaerygdr..vkawevvNEpnlvllgyldgtfapgllrdsatadalaghellaaafk
00513701   1/1  rdrnhPsvilWslgNEvggg...........afvkaladli-----------------------------
00475421   1/1  gayviidlgpggwee.aiaeglyddia...affaelaklkgagvpvifrlgnEmng..gwfwWgaggkdp
00365351   1/1  rlknhPsiiiWslgNEpggg...............ayvkalaelvkaldptrpvtygsggnd.....ads
00485651   1/1  nw......ldpllklakklknpgikllaslwss.........Pgwakpngqtvgsg--------------
00478971   1/1  yleafaryaralaerygdgpavigwqvlNEpggygylrgysppalaafrewlkakyglldalnkawgtvf
00386051   1/1  yl...valkrngdlvdavsvgNEillgllwpaggdlnwenlaallneareavkeld--------------
00501671   1/1  ivtlhhwdlPlwledyg..............gwlnpelveafaryarqva.rfgdr..vkywetfNEpnv
00484021   1/1  afadyvaavverykdhginvdawevwNEPnlgg...lwpgmladpeeyadllkalapalk....dakivv
00521731   1/1  ...ladilagaydayirqlaralkdlgvpvilrighEmng..gwfwwgvgnkgngadpenyvdlwrrvvd
00520611   1/1  vvielakrakalggivtldwhlsdpw...adpgkyt...tslalvgalldggslagvldglydd------
00377071   1/1  kelvsrlkdngvlvigiqvgNEpnggllwpegggadadnlaallnaaidairaagptglviiv.lgltda


                         -         *         -         -         -         -         +:350
query           MDPRHAAPAGNLTAAGANPVKLKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRDNI
00368991   1/1  ..dwspwsggnlsaladypvgldfddnlvysvHfYppfdfsgngasgtdasndllaewlealidwlkelg
00497161   1/1  ......pnwssdldlaaanplp...ddnlvysvHfYlpsdfsg...............lrdalkwlldng
00465561   1/1  ............wsqdldlaaadplpd...dnivysvHfYlpsdfsg...............lrdaaawl
00470991   1/1  .............wsgdltwvsalpllllpadpdnnlvysvHfYlpsdfsgt.wgtcvdkatlrerlrdl
00533671   1/1  ............dfaalnplpd...nndvysvHfYppsdfsg...............ledlldwakkngk
00465231   1/1  liiveg.................aawsgdwtglaalplpldlddpddnlvysvHyYlpsdfsgtsaewvv
00468911   1/1  nrliivgg.................pnwsqdldlaaldplgd...nnivysvHfYapyhfthqgagsiad
00459941   1/1  ......pnwsqdwdlalanpldllaladpddnlvysvHfYapsdfsg..............rlrdaldwl
00489921   1/1  fwyglldgvdfiallaad..........nidfysfHyYpp......wwggtg...dflpswieshidlar
00491621   1/1  dapvtvgdagdypaswrp........flggrlpe.ftdldlalladpvDfigvhyYpspdgggtsaegle
00506431   1/1  .....pnwsqdldlvlnnpllllladpddnlvysvHfYapygfsg.............srlrdaikwald
00502151   1/1  aadpdrpvivnganwdgdl........................llllgdnvDviglhyYppwdgsgtpkn
00500041   1/1  flreaadairaadpdapviveg.agglpgstdped.................fdlelladnvDfigvhyY
00520861   1/1  dpnhlvtvggegwyndssga..wrdpllslvgtdfaaglli.....dgidvysfHmYppswgt.......
00461221   1/1  llaylreaadairavdpdapvivg.................gynwsgdltladlaplgdp...idfiglH
00499081   1/1  asyp...........wldelldflkdngv......pvDfigvhyYtslvvkakpyfggsdnpd.....ln
00471221   1/1  dairaigdpnrliviggafwgla............ywsgfltgpdg.......ddnvvldvHyYlpfdft
00466071   1/1  ..........afwgldlwlgflplpagddnvvldvHyYppfdftgqgwdkdf....lidllcnlvdflkk
00501301   1/1  .............mdggkgdalpefvdelkalgvpvDfiglhyYp.......dwgw.pdpdglrdalnrl
00482951   1/1  ds............dallefldalkaagv..piDfiglhsYpglgd............gspdglraaldr
00490541   1/1  gwggmtpeeyaellraaakaikavdPdakvigggaagpdp................ptyldwldalldga
00459651   1/1  ....................dllapalDvvslhyYpgwyggsle..leialaglldyledhakk..pg..
00499771   1/1  .nwdaladllkaaadaiRaadpnakvvihldngwsadlsrafldplklpgv................dnd
00471901   1/1  s.......................dps.krgglpefvdellalggpiDfiglqaHyYpgl..........
00386071   1/1  gwvngsykaifd..allangvvllddfDvigvsyYpywsgsaslgt............lksllddladry
00499761   1/1  lgedyleaafkairaadpnaplfvndynwenpg........kldallelvdelkangvpiDg...iglhg
00467821   1/1  vkawevgNEpnlvagggyngsfldpalggdyleaafdairaadpdallivgdydflglnyytsa......
00484181   1/1  gadyleaafkairaadpnaplfvgdygaesdpd....................kgdrlpefldelkalgv
00504041   1/1  ...........wlrefldlcldngvylD.....fisfHpYgstavpeddtltylgwlvdpegflellael
00461761   1/1  aireadpdaklgigdypfygdtskpdrllefldell...............elgvpiDfiglhyYpslg.
00513701   1/1  ----------------------------------------------------------------------
00475421   1/1  eaykqlwrevidairavdpgtnliwvgnpnsdldtfgad.....................lldyyPGddy
00365351   1/1  lD..........................vislnyypgwygasypesgyallldllealklgkplflsEyg
00485651   1/1  ----------------------------------------------------------------------
00478971   1/1  wsmpygswdqilapsdtpatlnpgllldwyrfdadqlgdylkeaydalravdpdapvvvngmflf.....
00386051   1/1  ----------------------------------------------------------------------
00501671   1/1  vallgyllgifapgrkslkeayqalhnlllahakavraydpnakigivlnltwaypasdspedvlaaera
00484021   1/1  gdvngddld...............wldtfladp...gaagyvDfigvHwYpdtegpldlld.........
00521731   1/1  airstgpnnliwvwsp.nwdgads..................vtdlaayyPgddyvDivGldyYp..yyp
00520611   1/1  ----------------------------------------------------------------------
00377071   1/1  psa.............glfawffddllannkfladavDfigvnyYpyw........ggtiypnlldtald


                         -         -         -         -         *         -         -:420
query           APVWIGEMGASLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGLQTEWGV
00368991   1/1  kpvilgEfGaanndgtrakylealldyle.anglaldvw.......igwlfWslgpesgdtwgl.ldddw
00497161   1/1  k.pvfigEfGavnadgngelrlaylkalldlleeng..............igwlyWslgdngetygllvd
00465561   1/1  kdngv.pvfvgEfGavnadgngesrlaylkawldlleen..............gigwlyWslgdkgetyg
00470991   1/1  aawlvdngi.pvfigEfGagnadgdgarlayldalldllee..............ngigwtyWsagdnwg
00533671   1/1  .pvfvgEfGasnadgdgedraayldaild-----------------------------------------
00465231   1/1  dniglpgsdagesilpeglrnalnwlkdngi.pvfigEfGavnadnddsrikyldalldaleka......
00468911   1/1  kesleeslrdvldfaldkgi.pvfvgEfG-----------------------------------------
00459941   1/1  knngl.pvivgEfGaanadgdg..wlealldlleen..............gigwlyWswgdnsgdyglll
00489921   1/1  algkPvlvgEfgaattngs...yykavldllk--------------------------------------
00491621   1/1  adpdglldalralakry....gkPifitEfGwasgdgngdddarieyqaa--------------------
00506431   1/1  ngl.pvfvgEfGaantd..gagwlnalldlleen....gigwlyWswkgeggdyglldpdpdwdyndlta
00502151   1/1  wldpvdfafnpglgptafgseidpsglrdaldalkdlypk.gk.pifitEfGwagggsdaeqaeylkayl
00500041   1/1  Pygftlfdddgsglslesgwdidpdglra.llellkry...gk---------------------------
00520861   1/1  .........wgaswledhiadlalgkplvigEfgaslngg...tylkalldlakknggv.galfWslndn
00461221   1/1  yYppfggtgniagaltsfggvtgplpvsdlafgvlgwmndglpylivgewsraltdssilpsglrallew
00499081   1/1  ifpaglrallaalkdlypggk.pifitEfGvpsdggaggandeeqaaylrdy------------------
00471221   1/1  gtgaswdiliaglcnllaflkek....gv.pvivGEfgaa------------------------------
00466071   1/1  ygv.pvivgEfgaaltdcalwlngvglgaryd--------------------------------------
00501301   1/1  ary....g.kPifitEfGvstdgglhdtyrieyqaayleallkaiadgvnvigytlWgl-----------
00482951   1/1  laalgk.piwitEfgvssanpggldgdgepgdpaseeyqaaylkellkallsggnviegvtlWgl-----
00490541   1/1  gdyvDfisiHyYpdpggvdpde------------------------------------------------
00459651   1/1  kPiilsEygaasl.pslgtlepylpseeyqaeylkallellalrkgpglaGgf-----------------
00499771   1/1  viglhyYpp.......wsg.....tlddllsslknlaary------------------------------
00471901   1/1  ....idpeglrdlldrlaryg.kPiwitE-----------------------------------------
00386071   1/1  ......gk.pvivtEtGwpstggdldaavpsdldnipasvegqatyledllsavaavdgglglfyW....
00499761   1/1  ypylgl........--------------------------------------------------------
00467821   1/1  .yldfvdflkangvp...iDgiglhsy..-----------------------------------------
00484181   1/1  piDfiglhyYpslgvpa...........------------------------------------------
00504041   1/1  rellkeyggpglpiwitEwgvssgdgnpg-----------------------------------------
00461761   1/1  ...........eidpeglrdlldrl.ary-----------------------------------------
00513701   1/1  ----------------------------------------------------------------------
00475421   1/1  vDiiGldyYppwpgdgt......fieslva----------------------------------------
00365351   1/1  hssvpslg--------------------------------------------------------------
00485651   1/1  ----------------------------------------------------------------------
00478971   1/1  ...gdldlwgaagy--------------------------------------------------------
00386051   1/1  ----------------------------------------------------------------------
00501671   1/1  llfllgwfldplvn...g----------------------------------------------------
00484021   1/1  ...........apgk.piwiTEfgvstgpgl---------------------------------------
00521731   1/1  astde..atlsslkelldnlydfa.raygKpvl-------------------------------------
00520611   1/1  ----------------------------------------------------------------------
00377071   1/1  alasaygk.......pviitEtGwPssggdndqavpsvligdpasik-----------------------


                         -         -         +         -         -         -         -:490
query           GNYRPDQIAITDEMLMRPRN--------------------------------------------------
00368991   1/1  ltpdpetdallkpqlgklpdll------------------------------------------------
00497161   1/1  gwnrvtlseygpll--------------------------------------------------------
00465561   1/1  lld..wdtgslkpsgllllnr-------------------------------------------------
00470991   1/1  dyfglldrdtgtwy--------------------------------------------------------
00533671   1/1  ----------------------------------------------------------------------
00465231   1/1  ........gigwtyWslkdn--------------------------------------------------
00468911   1/1  ----------------------------------------------------------------------
00459941   1/1  p---------------------------------------------------------------------
00489921   1/1  ----------------------------------------------------------------------
00491621   1/1  ----------------------------------------------------------------------
00506431   1/1  ----------------------------------------------------------------------
00502151   1/1  eallka............----------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00520861   1/1  ....s-----------------------------------------------------------------
00461221   1/1  larygk.Pvfit----------------------------------------------------------
00499081   1/1  ----------------------------------------------------------------------
00471221   1/1  ----------------------------------------------------------------------
00466071   1/1  ----------------------------------------------------------------------
00501301   1/1  ----------------------------------------------------------------------
00482951   1/1  ----------------------------------------------------------------------
00490541   1/1  ----------------------------------------------------------------------
00459651   1/1  ----------------------------------------------------------------------
00499771   1/1  ----------------------------------------------------------------------
00471901   1/1  ----------------------------------------------------------------------
00386071   1/1  epawapgwedg-----------------------------------------------------------
00499761   1/1  ----------------------------------------------------------------------
00467821   1/1  ----------------------------------------------------------------------
00484181   1/1  ----------------------------------------------------------------------
00504041   1/1  ----------------------------------------------------------------------
00461761   1/1  ----------------------------------------------------------------------
00513701   1/1  ----------------------------------------------------------------------
00475421   1/1  ----------------------------------------------------------------------
00365351   1/1  ----------------------------------------------------------------------
00485651   1/1  ----------------------------------------------------------------------
00478971   1/1  ----------------------------------------------------------------------
00386051   1/1  ----------------------------------------------------------------------
00501671   1/1  ----------------------------------------------------------------------
00484021   1/1  ----------------------------------------------------------------------
00521731   1/1  ----------------------------------------------------------------------
00520611   1/1  ----------------------------------------------------------------------
00377071   1/1  ----------------------------------------------------------------------