[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38359.1


[Show Plain Result]

## Summary of Sequence Search
   1::539
  37::243  1.2e-56 41.0% 0039041 00390411 1/2   p containing nucleoside triphosphate hy 
  29::250  2.6e-56 38.3% 0037958 00379581 1/2   p containing nucleoside triphosphate hy 
  27::255  1.1e-55 36.2% 0047589 00475891 1/2   p containing nucleoside triphosphate hy 
  12::250    2e-55 34.9% 0042280 00422801 1/2   p containing nucleoside triphosphate hy 
  30::250    5e-54 39.4% 0037898 00378981 1/2   p containing nucleoside triphosphate hy 
  37::263    1e-53 38.5% 0040410 00404101 1/2   p containing nucleoside triphosphate hy 
  24::252  1.5e-53 37.0% 0036121 00361211 1/2   p containing nucleoside triphosphate hy 
  27::250  3.4e-53 38.5% 0050044 00500441 1/2   p containing nucleoside triphosphate hy 
  30::250  7.9e-53 37.4% 0048220 00482201 1/2   p containing nucleoside triphosphate hy 
  31::273    1e-52 30.5% 0045860 00458601 1/2   p containing nucleoside triphosphate hy 
  28::251  1.6e-52 37.5% 0046697 00466971 1/2   p containing nucleoside triphosphate hy 
  19::250  2.1e-52 35.7% 0047599 00475991 1/2   p containing nucleoside triphosphate hy 
  23::261    3e-52 34.8% 0044086 00440861 1/2   p containing nucleoside triphosphate hy 
  30::250  3.6e-52 38.9% 0042070 00420701 1/2   p containing nucleoside triphosphate hy 
  31::250  7.1e-52 37.1% 0048226 00482261 1/2   p containing nucleoside triphosphate hy 
  38::250    1e-51 37.5% 0046693 00466931 1/2   p containing nucleoside triphosphate hy 
  31::250  1.2e-51 39.0% 0050274 00502741 1/2   p containing nucleoside triphosphate hy 
  15::250  2.1e-51 34.9% 0053059 00530591 1/2   p containing nucleoside triphosphate hy 
  31::250  5.5e-51 33.0% 0049080 00490801 1/2   p containing nucleoside triphosphate hy 
  37::250  1.8e-50 33.5% 0051025 00510251 1/2   p containing nucleoside triphosphate hy 
  31::238  2.4e-50 39.7% 0043607 00436071 1/2   p containing nucleoside triphosphate hy 
  33::250  5.5e-50 37.7% 0042557 00425571 1/2   p containing nucleoside triphosphate hy 
  33::250  3.2e-49 35.7% 0036790 00367901 1/2   p containing nucleoside triphosphate hy 
  37::265  5.8e-47 33.5% 0050943 00509431 1/2   p containing nucleoside triphosphate hy 
  23::246  3.7e-44 34.7% 0048852 00488521 1/2   p containing nucleoside triphosphate hy 
   6::232    9e-44 36.1% 0043651 00436511 1/2   p containing nucleoside triphosphate hy 
  37::250  3.9e-43 36.8% 0049611 00496111 1/2   p containing nucleoside triphosphate hy 
  26::246  4.4e-43 36.0% 0049537 00495371 1/2   p containing nucleoside triphosphate hy 
  21::249  1.5e-42 38.7% 0037230 00372301 1/2   p containing nucleoside triphosphate hy 
  39::264  1.6e-42 33.5% 0048545 00485451 1/2   p containing nucleoside triphosphate hy 
  31::244  1.8e-42 35.6% 0046945 00469451 1/2   p containing nucleoside triphosphate hy 
  30::253  1.8e-41 35.4% 0046869 00468691 1/2   p containing nucleoside triphosphate hy 
   7::246  3.6e-41 32.2% 0049825 00498251 1/2   p containing nucleoside triphosphate hy 
  37::276    4e-40 34.5% 0037960 00379601 1/2   p containing nucleoside triphosphate hy 
  15::250  1.5e-39 33.0% 0042496 00424961 1/2   p containing nucleoside triphosphate hy 
  37::249    2e-39 34.0% 0050061 00500611 1/2   p containing nucleoside triphosphate hy 
  41::245    2e-39 37.1% 0050337 00503371 1/2   p containing nucleoside triphosphate hy 
  29::242  1.2e-38 37.6% 0043798 00437981 1/2   p containing nucleoside triphosphate hy 
  53::253  3.6e-37 38.3% 0048593 00485931 1/2   p containing nucleoside triphosphate hy 
  50::248  7.6e-37 36.0% 0046860 00468601 1/2   p containing nucleoside triphosphate hy 
  29::251  3.7e-36 36.2% 0042214 00422141 1/2   p containing nucleoside triphosphate hy 
  38::252  5.8e-36 37.5% 0036748 00367481 1/2   p containing nucleoside triphosphate hy 
 260::513  1.2e-34 26.0% 0042280 00422802 2/2   p containing nucleoside triphosphate hy 
 277::505  1.9e-34 30.6% 0037958 00379582 2/2   p containing nucleoside triphosphate hy 
  58::211  4.2e-33 38.3% 0038144 00381441 1/2   p containing nucleoside triphosphate hy 
   3::249  5.9e-33 27.9% 0037163 00371631 1/2   p containing nucleoside triphosphate hy 
  56::252  9.9e-33 39.8% 0041412 00414121 1/2   p containing nucleoside triphosphate hy 
  48::249  2.2e-32 36.5% 0044893 00448931 1/2   p containing nucleoside triphosphate hy 
  30::259  2.3e-32 33.2% 0046479 00464791 1/2   p containing nucleoside triphosphate hy 
 281::505  2.3e-32 31.2% 0049080 00490802 2/2   p containing nucleoside triphosphate hy 
 281::505    3e-32 31.2% 0051025 00510252 2/2   p containing nucleoside triphosphate hy 
  45::250    1e-31 38.4% 0053253 00532531 1/2   arboxykinase-like                       
 281::505  1.6e-31 29.5% 0045860 00458602 2/2   p containing nucleoside triphosphate hy 
 278::505  2.4e-31 29.6% 0042070 00420702 2/2   p containing nucleoside triphosphate hy 
 278::505  6.6e-31 29.9% 0037898 00378982 2/2   p containing nucleoside triphosphate hy 
  56::251  2.1e-30 38.7% 0045731 00457311 1/2   p containing nucleoside triphosphate hy 
  27::249  2.7e-30 29.9% 0049503 00495031 1/2   p containing nucleoside triphosphate hy 
  47::244  3.9e-30 34.0% 0047537 00475371 1/2   p containing nucleoside triphosphate hy 
 296::505  5.3e-30 28.3% 0039041 00390412 2/2   p containing nucleoside triphosphate hy 
 280::505  9.9e-30 27.9% 0048220 00482202 2/2   p containing nucleoside triphosphate hy 
 283::526  1.1e-29 30.5% 0040410 00404102 2/2   p containing nucleoside triphosphate hy 
 277::505  3.1e-29 29.0% 0047589 00475892 2/2   p containing nucleoside triphosphate hy 
 278::505  3.4e-29 28.3% 0046697 00466972 2/2   p containing nucleoside triphosphate hy 
 263::505  6.5e-29 28.3% 0053059 00530592 2/2   p containing nucleoside triphosphate hy 
 281::505  7.4e-29 29.8% 0042557 00425572 2/2   p containing nucleoside triphosphate hy 
  43::228  1.6e-28 37.1% 0047841 00478411 1/2   arboxykinase-like                       
  59::262  1.6e-28 31.1% 0051289 00512891 1/2   p containing nucleoside triphosphate hy 
 272::505  1.7e-28 29.6% 0036121 00361212 2/2   p containing nucleoside triphosphate hy 
 281::505  3.1e-28 30.2% 0048226 00482262 2/2   p containing nucleoside triphosphate hy 
  52::196  3.5e-28 36.4% 0048047 00480471 1/2   p containing nucleoside triphosphate hy 
  27::250  3.6e-28 31.5% 0036850 00368501 1/2   p containing nucleoside triphosphate hy 
 296::505  4.7e-28 27.9% 0046693 00466932 2/2   p containing nucleoside triphosphate hy 
 269::505    5e-28 28.4% 0047599 00475992 2/2   p containing nucleoside triphosphate hy 
 277::505  7.4e-28 29.0% 0050044 00500442 2/2   p containing nucleoside triphosphate hy 
 281::513  8.2e-28 28.8% 0036790 00367902 2/2   p containing nucleoside triphosphate hy 
 279::501  8.3e-28 30.2% 0043607 00436072 2/2   p containing nucleoside triphosphate hy 
 281::505    9e-28 31.3% 0050274 00502742 2/2   p containing nucleoside triphosphate hy 
  33::242    4e-27 30.7% 0037996 00379961 1/2   p containing nucleoside triphosphate hy 
  56::242    1e-26 31.8% 0042605 00426051 1/2   p containing nucleoside triphosphate hy 
  26::154  1.1e-26 37.9% 0038720 00387201 1/2   p containing nucleoside triphosphate hy 
  56::239  1.2e-26 33.5% 0047797 00477971 1/2   p containing nucleoside triphosphate hy 
  44::213  9.2e-26 34.0% 0047552 00475521 1/2   arboxykinase-like                       
 271::505  3.1e-25 31.0% 0044086 00440862 2/2   p containing nucleoside triphosphate hy 
 281::528  1.3e-24 26.9% 0050943 00509432 2/2   p containing nucleoside triphosphate hy 
  42::250    4e-24 33.3% 0046276 00462761 1/2   p containing nucleoside triphosphate hy 
  37::246  4.1e-24 30.6% 0048957 00489571 1/2   p containing nucleoside triphosphate hy 
  26::249  6.6e-24 34.0% 0043794 00437941 1/2   p containing nucleoside triphosphate hy 
  57::217  7.2e-24 33.8% 0051553 00515531 1/2   p containing nucleoside triphosphate hy 
  10::240  1.9e-23 28.2% 0036857 00368571 1/2   p containing nucleoside triphosphate hy 
  57::249    2e-23 34.6% 0049657 00496571 1/2   p containing nucleoside triphosphate hy 
 271::505  4.1e-23 27.1% 0048852 00488522 2/2   p containing nucleoside triphosphate hy 
  37::267  5.9e-23 30.7% 0050374 00503741 1/2   p containing nucleoside triphosphate hy 
 250::505  6.9e-23 29.4% 0049825 00498252 2/2   p containing nucleoside triphosphate hy 
  57::229  1.5e-21 37.4% 0047538 00475381 1/2   p containing nucleoside triphosphate hy 
  57::214  1.9e-21 31.8% 0051551 00515511 1/2   p containing nucleoside triphosphate hy 
  57::238  5.6e-21 33.5% 0053350 00533501 1/2   p containing nucleoside triphosphate hy 
  26::238  7.1e-21 27.1% 0037926 00379261 1/2   p containing nucleoside triphosphate hy 
  38::237  7.1e-21 28.5% 0043440 00434401 1/2   p containing nucleoside triphosphate hy 
  56::253  1.3e-20 34.6% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
 279::505  3.6e-20 27.0% 0046945 00469452 2/2   p containing nucleoside triphosphate hy 
  60::229  4.5e-20 35.1% 0048702 00487021 1/2   p containing nucleoside triphosphate hy 
  50::243  9.2e-20 27.8% 0049073 00490731 1/2   p containing nucleoside triphosphate hy 
  46::244  1.2e-19 27.7% 0046895 00468951 1/2   p containing nucleoside triphosphate hy 
  46::244  1.4e-19 27.1% 0051056 00510561 1/2   p containing nucleoside triphosphate hy 
 269::505  1.7e-19 32.2% 0037230 00372302 2/2   p containing nucleoside triphosphate hy 
  57::222  1.8e-19 31.8% 0048410 00484101 1/2   p containing nucleoside triphosphate hy 
 303::516  2.3e-19 28.7% 0048593 00485932 2/2   p containing nucleoside triphosphate hy 
  57::258  4.4e-19 29.7% 0049343 00493431 1/2   p containing nucleoside triphosphate hy 
  58::252  4.7e-19 30.2% 0040588 00405881 1/2   p containing nucleoside triphosphate hy 
 297::505  4.8e-19 32.6% 0049537 00495372 2/2   p containing nucleoside triphosphate hy 
 261::505  5.1e-19 27.1% 0042496 00424962 2/2   p containing nucleoside triphosphate hy 
 248::495  6.2e-19 25.5% 0043651 00436512 2/2   p containing nucleoside triphosphate hy 
 283::505  6.2e-19 27.6% 0049611 00496112 2/2   p containing nucleoside triphosphate hy 
  35::222  1.2e-18 31.2% 0035641 00356411 1/2   p containing nucleoside triphosphate hy 
 277::505  2.3e-18 31.7% 0043798 00437982 2/2   p containing nucleoside triphosphate hy 
  46::244    6e-18 27.1% 0049853 00498531 1/2   p containing nucleoside triphosphate hy 
 264::505  6.5e-18 29.3% 0046869 00468692 2/2   p containing nucleoside triphosphate hy 
  43::226    1e-17 29.9% 0047844 00478441 1/2   arboxykinase-like                       
 294::504  1.5e-17 28.4% 0048545 00485452 2/2   p containing nucleoside triphosphate hy 
  53::222    4e-17 32.2% 0045157 00451571 1/2   p containing nucleoside triphosphate hy 
 298::505    4e-17 27.9% 0044893 00448932 2/2   p containing nucleoside triphosphate hy 
 300::505  1.4e-16 27.3% 0046860 00468602 2/2   p containing nucleoside triphosphate hy 
  30::239  1.9e-16 29.5% 0040419 00404191 1/2   p containing nucleoside triphosphate hy 
  55::241    2e-16 23.5% 0043986 00439861 1/2   p containing nucleoside triphosphate hy 
  56::240    2e-16 30.6% 0049881 00498811 1/2   p containing nucleoside triphosphate hy 
  52::232  2.9e-16 22.1% 0047073 00470731 1/2   p containing nucleoside triphosphate hy 
 265::505  5.6e-16 33.3% 0036748 00367482 2/2   p containing nucleoside triphosphate hy 
  62::223  3.1e-15 29.3% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 297::505  4.1e-15 31.4% 0050061 00500612 2/2   p containing nucleoside triphosphate hy 
 281::505  7.4e-15 31.3% 0037960 00379602 2/2   p containing nucleoside triphosphate hy 
  57::229  9.4e-15 31.1% 0053247 00532471 1/2   p containing nucleoside triphosphate hy 
  18::258  1.1e-14 22.2% 0039472 00394721 1/2   p containing nucleoside triphosphate hy 
 298::505  1.4e-14 27.8% 0049503 00495032 2/2   p containing nucleoside triphosphate hy 
 280::503    2e-14 28.1% 0042214 00422142 2/2   p containing nucleoside triphosphate hy 
  42::240  2.1e-14 31.3% 0040678 00406781 1/2   p containing nucleoside triphosphate hy 
  57::262  2.1e-14 26.0% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
 277::508  3.3e-14 28.3% 0050337 00503372 2/2   p containing nucleoside triphosphate hy 
  52::269  4.9e-14 25.6% 0043218 00432181 1/2   p containing nucleoside triphosphate hy 
 297::505  1.1e-13 28.6% 0047537 00475372 2/2   p containing nucleoside triphosphate hy 
  51::218  1.3e-13 28.6% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
 295::505  1.3e-13 26.7% 0046479 00464792 2/2   p containing nucleoside triphosphate hy 
  26::260  2.3e-13 31.3% 0039270 00392701 1/2   p containing nucleoside triphosphate hy 
  45::242  3.2e-13 25.2% 0051325 00513251 1/2   p containing nucleoside triphosphate hy 
 283::505  4.5e-13 29.0% 0037996 00379962 2/2   p containing nucleoside triphosphate hy 
 306::504  4.7e-13 34.8% 0041412 00414122 2/2   p containing nucleoside triphosphate hy 
 308::473  6.2e-13 25.5% 0038144 00381442 2/2   p containing nucleoside triphosphate hy 
  57::239  1.2e-12 28.1% 0048963 00489631 1/2   p containing nucleoside triphosphate hy 
  52::255  1.8e-12 23.9% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  42::243  1.9e-12 31.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  59::244  2.2e-12 23.6% 0048044 00480441 1/2   p containing nucleoside triphosphate hy 
  57::249  3.1e-12 30.2% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  58::195  3.1e-12 31.6% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 309::505  3.8e-12 29.9% 0051289 00512892 2/2   p containing nucleoside triphosphate hy 
  36::260  1.9e-11 32.4% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  59::242  3.2e-11 24.7% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  27::262  7.9e-11 25.2% 0038674 00386741 1/2   p containing nucleoside triphosphate hy 
  56::213  2.1e-10 31.2% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
 296::505  7.4e-10 23.6% 0037163 00371632 2/2   p containing nucleoside triphosphate hy 
  52::232  1.5e-09 24.0% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  31::262    2e-09 24.0% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  38::225  3.5e-09 27.2% 0043792 00437921 1/2   p containing nucleoside triphosphate hy 
  51::241  4.2e-09 31.0% 0042094 00420941 1/2   p containing nucleoside triphosphate hy 
  28::260  4.4e-09 33.1% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
 274::505  4.9e-09 28.4% 0043794 00437942 2/2   p containing nucleoside triphosphate hy 
 282::504  5.2e-09 24.4% 0050374 00503742 2/2   p containing nucleoside triphosphate hy 
  51::191  7.3e-09 25.5% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 294::508  8.5e-09 26.7% 0047841 00478412 2/2   arboxykinase-like                       
 300::506  1.3e-08 25.8% 0049073 00490732 2/2   p containing nucleoside triphosphate hy 
  62::212  1.6e-08 24.8% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  51::225  1.8e-08 31.9% 0043790 00437901 1/2   p containing nucleoside triphosphate hy 
  57::213  2.3e-08 29.8% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
 306::505  2.3e-08 28.6% 0045731 00457312 2/2   p containing nucleoside triphosphate hy 
 306::505  2.5e-08 28.6% 0042605 00426052 2/2   p containing nucleoside triphosphate hy 
  49::220  5.4e-08 24.3% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 274::406  5.6e-08 29.6% 0038720 00387202 2/2   p containing nucleoside triphosphate hy 
 289::504  7.1e-08 20.1% 0043986 00439862 2/2   p containing nucleoside triphosphate hy 
  58::240  7.9e-08 27.7% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
 298::502  8.3e-08 27.3% 0040419 00404192 2/2   p containing nucleoside triphosphate hy 
  54::229  8.7e-08 24.8% 0047291 00472911 1/2   p containing nucleoside triphosphate hy 
 302::459  2.3e-07 25.7% 0048047 00480472 2/2   p containing nucleoside triphosphate hy 
 292::505  2.4e-07 27.9% 0046276 00462762 2/2   p containing nucleoside triphosphate hy 
  46::228  3.3e-07 25.2% 0041053 00410531 1/2   p containing nucleoside triphosphate hy 
  50::246  4.8e-07 20.2% 0048025 00480251 1/2   p containing nucleoside triphosphate hy 
  52::238  4.8e-07 26.9% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  50::209  4.9e-07 25.5% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  55::246  6.3e-07 21.5% 0048255 00482551 1/2   p containing nucleoside triphosphate hy 
  57::229  7.4e-07 25.2% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
 308::507  7.5e-07 25.3% 0040588 00405882 2/2   p containing nucleoside triphosphate hy 
 298::504  9.3e-07 27.3% 0051056 00510562 2/2   p containing nucleoside triphosphate hy 
 298::503  9.6e-07 26.2% 0049853 00498532 2/2   p containing nucleoside triphosphate hy 
  57::232  1.2e-06 25.0% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
 295::476  1.4e-06 28.7% 0047552 00475522 2/2   arboxykinase-like                       
 298::505  1.5e-06 27.2% 0046895 00468952 2/2   p containing nucleoside triphosphate hy 
 309::492  1.9e-06 29.4% 0048702 00487022 2/2   p containing nucleoside triphosphate hy 
 282::509    2e-06 24.2% 0048957 00489572 2/2   p containing nucleoside triphosphate hy 
  42::84   2.5e-06 34.9% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  54::229  7.9e-06 23.4% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  58::238  9.8e-06 23.5% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  51::337    1e-05 26.5% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
 262::492    1e-05 22.5% 0036857 00368572 2/2   p containing nucleoside triphosphate hy 
 307::480  1.2e-05 23.3% 0051553 00515532 2/2   p containing nucleoside triphosphate hy 
 306::502  1.5e-05 27.1% 0047797 00477972 2/2   p containing nucleoside triphosphate hy 
  26::248  1.7e-05 25.3% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
 297::505  1.8e-05 23.9% 0036850 00368502 2/2   p containing nucleoside triphosphate hy 
  53::229  3.4e-05 24.4% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  54::333  3.7e-05 27.3% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 296::500  4.4e-05 24.8% 0043440 00434402 2/2   p containing nucleoside triphosphate hy 
  51::260    5e-05 28.9% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  57::230  6.4e-05 21.8% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  58::229  7.5e-05 22.8% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  50::258  8.4e-05 33.0% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
 295::505  0.00011 29.5% 0053253 00532532 2/2   arboxykinase-like                       
 303::485  0.00014 22.3% 0045157 00451572 2/2   p containing nucleoside triphosphate hy 
  58::191  0.00017 28.0% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  51::93   0.00033 34.9% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  57::221  0.00074 27.3% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
 308::475  0.00088 24.7% 0048410 00484102 2/2   p containing nucleoside triphosphate hy 
 298::503   0.0013 27.3% 0040678 00406782 2/2   p containing nucleoside triphosphate hy 
 294::488   0.0027 26.1% 0047844 00478442 2/2   arboxykinase-like                       
 294::492   0.0036 24.4% 0043792 00437922 2/2   p containing nucleoside triphosphate hy 
 307::492   0.0083 26.0% 0053247 00532472 2/2   p containing nucleoside triphosphate hy 
 298::505    0.014 28.5% 0039270 00392702 2/2   p containing nucleoside triphosphate hy 
 308::513    0.017 21.9% 0053350 00533502 2/2   p containing nucleoside triphosphate hy 
 298::507     0.02 20.6% 0037926 00379262 2/2   p containing nucleoside triphosphate hy 
 300::505    0.032 19.5% 0048025 00480252 2/2   p containing nucleoside triphosphate hy 
 298::504     0.05 24.1% 0048255 00482552 2/2   p containing nucleoside triphosphate hy 
 308::492    0.069 27.0% 0047538 00475382 2/2   p containing nucleoside triphosphate hy 
 308::504     0.14 23.9% 0049343 00493432 2/2   p containing nucleoside triphosphate hy 
 302::503     0.29 26.9% 0043218 00432182 2/2   p containing nucleoside triphosphate hy 
 307::477     0.87 24.5% 0051551 00515512 2/2   p containing nucleoside triphosphate hy 
 308::503     0.87 24.3% 0049881 00498812 2/2   p containing nucleoside triphosphate hy 
 426::485      2.4 27.6% 0035641 00356412 2/2   p containing nucleoside triphosphate hy 
 298::492      2.7 28.4% 0038674 00386742 2/2   p containing nucleoside triphosphate hy 
 302::495      3.5 20.8% 0047073 00470732 2/2   p containing nucleoside triphosphate hy 
 295::505      5.2 22.1% 0051325 00513252 2/2   p containing nucleoside triphosphate hy 
 301::492      5.5 27.0% 0043790 00437902 2/2   p containing nucleoside triphosphate hy 
 268::504      5.8 25.8% 0042094 00420942 2/2   p containing nucleoside triphosphate hy 
 308::492      7.9 23.5% 0047291 00472912 2/2   p containing nucleoside triphosphate hy 
 308::506      9.7 23.5% 0048963 00489632 2/2   p containing nucleoside triphosphate hy 
 428::505       19 25.6% 0048044 00480442 2/2   p containing nucleoside triphosphate hy 
 307::505       22 23.6% 0049657 00496572 2/2   p containing nucleoside triphosphate hy 
 268::489       25 18.7% 0039472 00394722 2/2   p containing nucleoside triphosphate hy 
 296::343       39 29.2% 0041053 00410532 2/2   p containing nucleoside triphosphate hy 
   1::539


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEERSAQLNYTSSSQDRPSDASAAAPPERPPLFQGLGLTKRYGDFTANSAIDIAIAPGQIHALLGENGAG
00390411   1/2  ------------------------------------MknlslrygnfralkdvslelppG.ltalvGpNG
00379581   1/2  ----------------------------lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsG
00475891   1/2  --------------------------lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsG
00422801   1/2  -----------llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnG
00378981   1/2  -----------------------------lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaG
00404101   1/2  ------------------------------------elenlsksyggvlalkdvsltvepgeivalvGpn
00361211   1/2  -----------------------plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsG
00500441   1/2  --------------------------lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaG
00482201   1/2  -----------------------------llllelknlsksyggvlalkdvsltikpgeivalvGpnGsG
00458601   1/2  ------------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsG
00466971   1/2  ---------------------------llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsG
00475991   1/2  ------------------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsG
00440861   1/2  ----------------------MpllslgepllelenlsksyggvvalkdislsipkGeildlldellel
00420701   1/2  -----------------------------lpllelenlsksypgggvlalkdvsltvepgeivalvGpnG
00482261   1/2  ------------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsG
00466931   1/2  -------------------------------------Mkllslslgnfralkdvslelp.geltalvGpN
00502741   1/2  ------------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsG
00530591   1/2  --------------llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsG
00490801   1/2  ------------------------------llllllllalllelleeeeellllllalllllgdpllele
00510251   1/2  ------------------------------------lllllllllaeellelleeeelllllllllllll
00436071   1/2  ------------------------------pllelenlsksygg.lalkdvsltvepgeivalvGpnGaG
00425571   1/2  --------------------------------lelenlsksyggvlalkdvsltvepgeivalvGpnGaG
00367901   1/2  --------------------------------lelknlslsyg.ksilkdvsleip.geltalvGpnGsG
00509431   1/2  ------------------------------------Mlelknlslsnfrvlkdelvslefepg.ltaivG
00488521   1/2  ----------------------lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsG
00436511   1/2  -----ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvslt
00496111   1/2  ------------------------------------elenltklytgikaLddllslgippGeivllvGp
00495371   1/2  -------------------------esalellleledltklstgikaLddv.lggglpkGeivlllGpsG
00372301   1/2  --------------------yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaG
00485451   1/2  --------------------------------------skiygd.ealkdvsleikkllnlsgkpgeiig
00469451   1/2  ------------------------------allelenlskiyggvpkalddvslgiepGeivalvGpsGs
00468691   1/2  -----------------------------lsvpvglallgrvldvlgepidglgplllllllpivrlapp
00498251   1/2  ------vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGps
00379601   1/2  ------------------------------------nlsfsyggkealkdlslaiepgelvlivGptGsG
00424961   1/2  --------------lgepldglgplr.papgllelenvsksygtgialidlslpigkGervalvGpsGaG
00500611   1/2  ------------------------------------pgllsllelllelenltklptgipaLddv.lggg
00503371   1/2  ----------------------------------------Mmlkslelknfkslkdvsligdfspg.lta
00437981   1/2  ----------------------------lveklrpknldkvigqeealkdlslalkpgeiphalllvGpp
00485931   1/2  ----------------------------------------------------LsvpkgevvalvGpnGaG
00468601   1/2  -------------------------------------------------dlslevkkgevialvGpnGvG
00422141   1/2  ----------------------------dlsleelekllelllrdllglgplvklldplleeavvngasd
00367481   1/2  -------------------------------------yvrPelldepllelengrhPllsksyggkvvln
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00381441   1/2  ---------------------------------------------------------GeliaivGpsGsG
00371631   1/2  --mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrll
00414121   1/2  -------------------------------------------------------kpgevvllvGpsGaG
00448931   1/2  -----------------------------------------------LddvslsvepgevialvGpnGsG
00464791   1/2  -----------------------------lsvpvgdkllGrvldvlgepidglgpllalerlpierlapp
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00532531   1/2  --------------------------------------------vlalkdvslviekGevvallGlSGsG
00458602   2/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00457311   1/2  -------------------------------------------------------mkkgeiigivGpsGs
00495031   1/2  --------------------------lsalellleledltkistgipaLddvlsggipkGelvllvGpsG
00475371   1/2  ----------------------------------------------alddvslsikkgevialvGkgGvG
00390412   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00478411   1/2  ------------------------------------------Ggvlalhgvsldve.gevvlltGpsGsG
00512891   1/2  ----------------------------------------------------------evilltGppGvG
00361212   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00480471   1/2  ---------------------------------------------------sleikkgekvaivGpsGsG
00368501   1/2  --------------------------kerllllelrnvllddviGqeeakealsealelplkrpelfdgl
00466932   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00379961   1/2  --------------------------------yrpvdfddivGqeealralslalaagppegvllvGppG
00426051   1/2  -------------------------------------------------------kpgevialvGpsGsG
00387201   1/2  -------------------------mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaG
00477971   1/2  -------------------------------------------------------hkgelvvlvGPsGaG
00475521   1/2  -------------------------------------------evlalhgvsldve.gevvllvGpsGsG
00440862   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00462761   1/2  -----------------------------------------yygdvtaldgvsltikkgevialvGpsGs
00489571   1/2  ------------------------------------rvknlsksyggktalddvslsvepG.ivgLlGpN
00437941   1/2  -------------------------lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppG
00515531   1/2  --------------------------------------------------------kgekvallGlsgsG
00368571   1/2  ---------llgvrllpplppklagllplagladgdglgvllGkll..dgvpvtldlgelgrhllivGpt
00496571   1/2  --------------------------------------------------------GkgelivllGpsGs
00488522   2/2  ----------------------------------------------------------------------
00503741   1/2  ------------------------------------fifldlrplallplpdrlvgrdeeiealskalgg
00498252   2/2  ----------------------------------------------------------------------
00475381   1/2  --------------------------------------------------------mkgeiialtGpsGs
00515511   1/2  --------------------------------------------------------kgekvlllGlsgsG
00533501   1/2  --------------------------------------------------------rgeiialtGpsGsG
00379261   1/2  -------------------------drllleelrpvllddviGqeeakealsealrlplkrlelferlgl
00434401   1/2  -------------------------------------lsksyggllalddvslsvkkgliigitGpsGsG
00464411   1/1  -------------------------------------------------------vkkgeiivllGpsGs
00469452   2/2  ----------------------------------------------------------------------
00487021   1/2  -----------------------------------------------------------rmkiivltGps
00490731   1/2  -------------------------------------------------dvslsvkkgkvialvGkgGvG
00468951   1/2  ---------------------------------------------lnvlgesidalgkilseilkllekg
00510561   1/2  ---------------------------------------------ldglgepldgllpilaklfrpievl
00372302   2/2  ----------------------------------------------------------------------
00484101   1/2  --------------------------------------------------------kgpvigivGpsGsG
00485932   2/2  ----------------------------------------------------------------------
00493431   1/2  --------------------------------------------------------kGelivllGpsGaG
00405881   1/2  ---------------------------------------------------------gervglvGrpgaG
00495372   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------lknlsksygilkalkdislelkkgikilllGlsgsG
00437982   2/2  ----------------------------------------------------------------------
00498531   1/2  ---------------------------------------------ldklgkildlalkileksflklevl
00468692   2/2  ----------------------------------------------------------------------
00478441   1/2  ------------------------------------------aevlalhgvsldin.gegvlivGpsGsG
00485452   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------MsikkgeiiaivGppGsG
00448932   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00404191   1/2  -----------------------------vellpkvtlddlvgleelkealkealellslgikpgeivll
00439861   1/2  ------------------------------------------------------kleeveristgipeld
00498811   1/2  -------------------------------------------------------kPgkiigltGpsGsG
00470731   1/2  ---------------------------------------------------arpltfddvvgqdeakeel
00367482   2/2  ----------------------------------------------------------------------
00477011   1/1  -------------------------------------------------------------eelrklldl
00500612   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00532471   1/2  --------------------------------------------------------pGkiIvitGpsGsG
00394721   1/2  -----------------lvslleslelplleklrpvllddvvgreealeallealrrgpprnvlLvGppG
00495032   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00406781   1/2  -----------------------------------------aglrlllkdlslgippgknvllvGppGtG
00402371   1/1  --------------------------------------------------------pgrnvllvGppGvG
00503372   2/2  ----------------------------------------------------------------------
00432181   1/2  ---------------------------------------------------slelkkglkvalvGrpgvG
00475372   2/2  ----------------------------------------------------------------------
00508671   1/1  --------------------------------------------------hvsllklgeldislsikkge
00464792   2/2  ----------------------------------------------------------------------
00392701   1/2  -------------------------eklrpvllddvvgqeeakeallealagarlaledlslgirpgknv
00513251   1/2  --------------------------------------------iellsdlslsipspevvllvGppGsG
00379962   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00489631   1/2  --------------------------------------------------------MkgklillvGppGs
00499331   1/1  ---------------------------------------------------PslslkkgklivltGppGs
00444381   1/1  -----------------------------------------asdelekllelrpvlledvigqeeakkal
00480441   1/2  ----------------------------------------------------------rlivllGpsGaG
00499191   1/1  --------------------------------------------------------kgkiigitGpsGsG
00515351   1/1  ---------------------------------------------------------mngklivltGppG
00512892   2/2  ----------------------------------------------------------------------
00367291   1/1  -----------------------------------vtlddvvgqeeakeallealelalkgldlflslgl
00513761   1/1  ----------------------------------------------------------kiiaivGkgGsG
00386741   1/2  --------------------------klrpvllddvvgqeeakeallealkavllgirpgehllLvGppG
00461621   1/1  -------------------------------------------------------mkgmiialtGppGsG
00371632   2/2  ----------------------------------------------------------------------
00533151   1/1  ---------------------------------------------------MsldikkgklivltGppGs
00473941   1/1  ------------------------------eklrpvllddvvgqeevkkalllalalallrgepgehvlL
00437921   1/2  -------------------------------------lglllveklrpkllddvvgqeealerlllalka
00420941   1/2  --------------------------------------------------lslgirpgkgvllyGppGtG
00521551   1/1  ---------------------------plveklrpvllddvigqeeakeallealarlkapelflslglr
00437942   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00517691   1/1  --------------------------------------------------lsfelkpglnvgivGhvgaG
00478412   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00469161   1/1  -------------------------------------------------------------llIvieGpp
00437901   1/2  --------------------------------------------------lslgirpgrillLyGppGvG
00476071   1/1  --------------------------------------------------------kgkiigltGpsGsG
00457312   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00527261   1/1  ------------------------------------------------npfilgpkvdledfigreeelk
00387202   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00478081   1/1  ---------------------------------------------------------gkvivltGppGsG
00404192   2/2  ----------------------------------------------------------------------
00472911   1/2  -----------------------------------------------------mkmkkgklilltGppGs
00480472   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00410531   1/2  ---------------------------------------------gelknlslelkkglkillvGlngvG
00480251   1/2  -------------------------------------------------EdlslavgkgkvialvGkgGv
00511381   1/1  ---------------------------------------------------llllkpgglvlitGPtgsG
00416171   1/1  -------------------------------------------------alslaartgenvllvGppGtG
00482551   1/2  ------------------------------------------------------everlstgipalDell
00519581   1/1  --------------------------------------------------------kpkvilltGppGvG
00405882   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00457851   1/1  --------------------------------------------------------PkgklivltGppGs
00475522   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00410321   1/1  -----------------------------------------yggllllkdlslelkkglkilllGlngaG
00478391   1/1  -----------------------------------------------------msikkgklilltGppGs
00496061   1/1  ---------------------------------------------------------gklivltGppGsG
00409841   1/1  --------------------------------------------------lslelkkglkvalvGrpgvG
00368572   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00418301   1/1  -------------------------drplleklrpvllddviGqeeakkallealalplkrlelfeklrg
00368502   2/2  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------lsikkgklivltGppGsG
00401211   1/1  -----------------------------------------------------elkrglnvgivGhvgaG
00434402   2/2  ----------------------------------------------------------------------
00430121   1/1  --------------------------------------------------lelgirpggnvllvGPpGvG
00477561   1/1  --------------------------------------------------------kkpkvillvGppGs
00482721   1/1  ---------------------------------------------------------kgkiigltGpsGs
00482661   1/1  -------------------------------------------------kkvaivllsnyalsislddll
00532532   2/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00493171   1/1  ---------------------------------------------------------mgklivllGpsGa
00495771   1/1  --------------------------------------------------illdilkgktvalvGpsGvG
00487061   1/1  --------------------------------------------------------ldMkkgklIvieGp
00484102   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KSTLVKTICGLIQPDDGAMRWRGAPFAPAGPADAQACGIGLVSQHFALFDNLTVAENVALGQRGGESLDI
00390411   1/2  sGKStLlkalagllgpdsglrvgklsdlirrgadkasvelvfeldggllallrllslsggeklrvalaka
00379581   1/2  KSTllkllagllkptsGeilldglditalslaelrrrgigyvfqdpalfpgltvrenlalglllllllll
00475891   1/2  KSTllkllagllkptsGeilldgkdilglsllellrrgigyvfqdpalfpgltvlenlllgllllglalk
00422801   1/2  sGKSTllkllagllkptsGeilldgldilalslaelrr.rigyvfqdpalfp.ltvrenlalglllalll
00378981   1/2  KSTllkllagllkptsGeilldgldllllslaelllllrrgigyvfqdpalfpgltvrenlalglllagl
00404101   1/2  GaGKSTllkllagll.ptsGeilldgldltalslael.rrgigyvfqdpalfpgltvrenlalgll....
00361211   1/2  KStllrnllagllaptggsvlldgleisalslaerlragigyvfqdlalfpeltvlenlalg........
00500441   1/2  KSTllkllagllkptsGeilldgkdildlsl...lrrgigyvfqdpalfpgltvlenlllgllllglsla
00482201   1/2  KSTllkllagllkptsGeilldgkdilglslkel..rgigyvvqqdallpsltvlenlllgllllgllll
00458601   1/2  KSTllkllagllkptsGeilldgkditglspqelrrlggvvvqevllffltllenlllglallllllvll
00466971   1/2  KSTllkllagllkptsGeilldgkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllgl
00475991   1/2  KSTllkllagllkptsGeilldgkdildlslael..rgigyvfqqdallpsltvlenlllglllagelll
00440861   1/2  lkeldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlg
00420701   1/2  sGKSTllkllagllkptsGeilldgldllllslaellalrrgigyvfqdpalfpgltvrenlalglllag
00482261   1/2  KSTllkllagllkptsGeilldgkdildlslael..rgigyvfqqdallpsltvlenlllgllllgelll
00466931   1/2  GsGKStLlkalagllgpdsGeilldgkdilalspeellrllrrrigyvfqepalfpgltveenlllglll
00502741   1/2  KSTllkllagllkptsGeilldgkdilglslael..rgigyvfqqlallpsltvlenlalgllllglska
00530591   1/2  KSTllkllagllkptsGeilldgkditdlslkel..rgigyvvqqdallpsltvlenlllgllllgllll
00490801   1/2  nlsksyggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrr
00510251   1/2  gdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditg
00436071   1/2  KsTllkllagllkptsgeilldgldlla......lrrgigyvfqdpalfpgltvlenlalgllllgll.e
00425571   1/2  KSTllkllagllkptsGeilldgldllalsl...lrrrigyvfqdpalfpgltvrenlalgllllglska
00367901   1/2  KStllkalagllgpdvsallrlsglidlilkgllllprstvatvelifdllgllliirrlilrdgsgeil
00509431   1/2  pNGsGKStlldalagllggrslrllragglsdliflgslirsgadrasvelvfdlsdglyllerselilr
00488521   1/2  KTtLllqlavngllppdsGei................ggkvlyvdqeeslfp.ltvlenlalg.......
00436511   1/2  ikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrr.rigyvfq
00496111   1/2  sGsGKTtlalrllagllkptggkvliiglelsaeelrerr.rrigyvfqepalfpeltvlenlalgll..
00495371   1/2  sGKttlalrllagllkp...evlvdgldltglspa...rggiglvfqteallppltvrenlealgldlrg
00372301   1/2  KSTllrllaglllpasggilvdgedlr...........igyvfq..........................
00485451   1/2  ivGpsGsGKsTllrlLagllkpllltggkvlvigldifrlsarelrkrig...vfqdpallphltvpenl
00469451   1/2  GKstllrllagllaglptsGeillldgkdvlylsleesleqlrrrigyvfqdpalfp.............
00468691   1/2  llelenlsksygtgialidvsltigrGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlr..el
00498251   1/2  GsGKTtLalrllagllkpgggvvyidgeesldll....rarrlgvvlqelllfpeltveenl........
00379601   1/2  KTTllkallgllppdegiitiegpdel.......lrnkigyvfQdpvlfp.ltvren.............
00424961   1/2  KttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyf
00500611   1/2  ipkGeivllvGpsGsGKTtlllqlagllapdsgeillggkvlyisleeslrrrrigmvfqelgldpdltv
00503371   1/2  ivGpNGsGKStlldaiagllgpdsgeirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllg
00437981   1/2  GsGKttlaralagllgpdsgkilldgkdi.........rrgiglvfqliglfphltvlelvalgl.ggil
00485931   1/2  KTTllallagllaptggkvllvgadi..........rrigavpqlpvlfprltvlenlalg......gad
00468601   1/2  KTTllakLagllapqggkvlllgaDiyraaaae..rlgigavpqdvplfpsltvldnlalardlleaa.k
00422141   1/2  ihiepgggllrvryridgvlielifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrv
00367481   1/2  dislsip.gellvitGPngsGKSTllralaglllpasggilvpgedalll....................
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00381441   1/2  KsTLlklLagllppdsgsigslttrlprlgevdgvdltfls.....reeigyvfqepallpdltvlenly
00371631   1/2  gklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlkrigllf
00414121   1/2  KTTLlrallglleglkvaviepdfgeilidgqll.edlgvlavrlgigyvpqtlglfpaltvlellalal
00448931   1/2  KTTllnalagllapdggkvllvgadiarla....areqlgivfqdp....gltvlenlalg........e
00464791   1/2  llelenlskrfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvygligerpre
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00532531   1/2  KTTLlrllagllipddgeilidggdinleggfyakaigllrrkigyvfq...lfpfltvlenvalgld.g
00458602   2/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00457311   1/2  GKSTlarllagllekpgsgvividgddlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrl
00495031   1/2  sGKTtlllqlagllalglgliplggkvlyiglelt.lsperlrlraqsl.....................
00475371   1/2  KTTlaanlagllaptggkvlligaDi........................................rrps
00390412   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00478411   1/2  KStllralagl.....Gtilldg.dlvrlglkd....gigmvfqdpalfplltvrengvalglllaglsk
00512891   1/2  KTTlakalagelgakfgsvsltgrdv......rsarrgigyvfq........tveellgllaelvgle..
00361212   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00480471   1/2  KSTLlnaLagllsptsvpettrdfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdll
00368501   1/2  gvelpgknvlLvGppGvGKTtlaralakll..........gapfiridgseltekdyvGesvearlrelf
00466932   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00379961   1/2  tGKstlaralagllppdsg....................rivlvgnlsdlldpkdlrellra.giplvfl
00426051   1/2  KSTlakllakelglefidsgdilrdgvdlggesglllrdlrrl.iglvfqdpilfpgltvglllffldni
00387201   1/2  KTtLlralagllgptsfvvsptftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelr
00477971   1/2  KsTLlnaLlgll.ptsgvisvsgttr...pprpgevdgvgyvfqsrelfpeltvagnflegaevrgnlyg
00475521   1/2  KStllralag.....sGeilvdg.dlvdleplrr...digmvfqdpalfplltvrenvilgllelaglsk
00440862   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00462761   1/2  GKsTlaraLagllpeepgsgvvlldgddlr.......lglliglvfqdpdllpfltvlenvllpllaagl
00489571   1/2  GaGKSTllrllaGllkpt....................................................
00437941   1/2  tGKTtlakalaglllptsg.....gvrvlgidaselld................................
00515531   1/2  KSTllnrllglefaygpTigptsgtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsf
00368571   1/2  GsGKStllrllaglllpdggrviviDpkgeyaglarglgvvildpgd....grsvrlnplaliddeedaa
00496571   1/2  GKsTlarlLagll...ggsvldtgepirgeplgelir...glvfqdpllldeltvlenlalgrylhlgli
00488522   2/2  ----------------------------------------------------------------------
00503741   1/2  ..aldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfg............kvvyvnvse
00498252   2/2  ----------------------------------------------------------------------
00475381   1/2  GKsTlarlLagllkptsgivsvdglrlavlsrdllgllreglirigyvfqdyalfprltvlenvllgll.
00515511   1/2  KSTllnrllgleflpgpTigptegtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsl
00533501   1/2  KsTlaklLaellphldtgdvlldgepigtp.....lgrgigyvfqdpalfpgltvrenlelllvfadryg
00379261   1/2  rrpgknvlLvGppGvGKTtlaralAkllgapfvevdaselteggyvgedlekr.........irelfqea
00434401   1/2  KTTlaraLaellrerggsvavidlddfyrpaaelllreglgidfqlpdal....................
00464411   1/1  GKsTlaklLagllgptggsvlltgepvsgeplge....ligevfqdgilfpdltvlenvalgrygllgli
00469452   2/2  ----------------------------------------------------------------------
00487021   1/2  GsGKsTlarlLaell....gvvvidtddllra..........gevfqdyalfphltvlelldnvllglei
00490731   1/2  KTTlaaklagllakrggkvllidaDp........................................yrpa
00468951   1/2  fltalgllerksverlstgikaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid
00510561   1/2  algllerksverlstGikaLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyistee
00372302   2/2  ----------------------------------------------------------------------
00484101   1/2  KTTllraLagllkprggrvavigldigrldldellg..igylfqdvgllpvltvrenlalllrglpgysa
00485932   2/2  ----------------------------------------------------------------------
00493431   1/2  KsTllkllagllgptsgvisvggttreprpgevr...gigyvfqsgalfphlivagnllegaevhgllyg
00405881   1/2  KSTLlnaltglkaivsgypgttldpnlgvveldd...................grqlvlvDtpGlielas
00495372   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00356411   1/2  KSTllnrllgleygpTiginegtieidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsfln
00437982   2/2  ----------------------------------------------------------------------
00498531   1/2  algvlerkeverlstGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyistee
00468692   2/2  ----------------------------------------------------------------------
00478441   1/2  KStlalaLagl.....Gailvdd.dlvllelrg...rdilmvfqppalfpllevrglniaevlelaglsk
00485452   2/2  ----------------------------------------------------------------------
00451571   1/2  KsTlaklLakll..........glivldgddllrea..iglvtqdgelllelid.egilvp......dei
00448932   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00404191   1/2  yGppGtGKTtlakalanelkkrggrvlyvsa.......................................
00439861   1/2  ellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle.esreqlleraerlgldleelll
00498811   1/2  KsTlarlLael...........gvividgddltrelvaggglliglifqdfglfelldrellielllenl
00470731   1/2  eellagllgikkpkvillvGppGsGKTTlaralakel..gagfilidgddlrekavgeleklgr...dlf
00367482   2/2  ----------------------------------------------------------------------
00477011   1/1  idklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrlsetpgltvlvvfl
00500612   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00532471   1/2  KsTlarlLaellnglggivsvddlgrdvgelggaalldivdegrliglvfqdldllpllevlellaa...
00394721   1/2  vGKTtlakalakelaagsgpilldgvpv..........................................
00495032   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00406781   1/2  KTtlakalagelgvpfvrisa.................................................
00402371   1/1  KTtlaralagllvrssgpilldgvpfvrldaselle..................................
00503372   2/2  ----------------------------------------------------------------------
00432181   1/2  KStLlnallglkvaivsdypgttrdptlgvveldgrkl................................
00475372   2/2  ----------------------------------------------------------------------
00508671   1/1  vivlvGpsGsGKsTlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrr.lgevfqelll
00464792   2/2  ----------------------------------------------------------------------
00392701   1/2  lLvGppGvGKTtlaralagllgapfgrvdasd......................................
00513251   1/2  Kstlakklaellgfilidaddlr...............................................
00379962   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00489631   1/2  GKtTlaraLaellglpf..iridgddllrellgellgrgigfgfqqgdlledatvlenlalllldeidka
00499331   1/1  GKtTlakaLaerlglpfidtddllrepvig........agtdigevfqdlllaggllvddev........
00444381   1/1  slalelplkrlelfgklddligrspairrllellgarpgenvlLvGppGtGKTtlakalakll.......
00480441   1/2  KsTlaklLaell.p..glivisvgdttr.epregevlgvdyvfvdrelfeelivagnlled...aivhgl
00499191   1/1  KsTlaklLaellgatvgdvd...............gllvgvvfqddfylllpalevlengaflldlllpd
00515351   1/1  sGKtTlaraLaerlglpvistddllreav.........pggtdigelfqdyllfpfltvdeni.......
00512892   2/2  ----------------------------------------------------------------------
00367291   1/1  rpgrnvllyGppGtGKTtlaralanel..........gapfirvdase......................
00513761   1/1  KTTllnklaglla.dggkvlvidlDparanlpeqlgidirdl......idletvme.lglgpngalvfal
00386741   1/2  tGKTtlaralagelga......................................................
00461621   1/1  KsTlaklLaerlglpfistddlyrevvergtelgklikdyfdpgalvpd..llirlllerllfldegggf
00371632   2/2  ----------------------------------------------------------------------
00533151   1/1  GKtTlarlLaerlglpfistddllrelvpggldig.............evfqda.leaglllfddefrgl
00473941   1/1  vGppGtGKTtlaralagllga.................................................
00437921   1/2  gklphlllvGppGvGKTtlaralarlllgsgggvdvielda.............................
00420941   1/2  KTtlakalagel..gapfiridg...............................................
00521551   1/1  pgkgvlLvGppGtGKTtlaralagll..........gapfvrlsas........................
00437942   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00517691   1/1  KSTLlnallgllgaivgdvlvdg...............................................
00478412   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00469161   1/1  GsGKsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdlilvpdllvlellaanraglre
00437901   1/2  KTtlakalakel..........gapvieidaselrd..................................
00476071   1/1  KsTlaklLaelglpvidtddltregvll.......................ggpllerirellgegyllf
00457312   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00527261   1/1  eleeal..pkivlltGprGsGKTtllkalakel..gkpviyidlselsskgyvdleellrelaeelgell
00387202   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00478081   1/1  KtTlarlLaellkplgg.....gvvvidt.......................................dd
00404192   2/2  ----------------------------------------------------------------------
00472911   1/2  GKtTlaraLaellgapfisgddllrglageggkpl...................................
00480472   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00410531   1/2  KTtllkrlag.................................gefv.dygptigvnfktvevdgvkl..
00480251   1/2  GKTTtaakLaaalaergk..kvllidlDpyrpsapeqlgilgellgvpvvgvltgldlagalrealell.
00511381   1/1  KsttLlralnrleeagkgvilv.kdaidtrlgielvvsriglvleavglffaldllelll..........
00416171   1/1  Kttlaralakllprsgvpfvrvncsalte.........................................
00482551   1/2  gGglppgslvliaGppGsGKTtlalqlaanaalp..................lelgklggkvlyisteea
00519581   1/1  KttlarlLakllglpliidldalaellfgdvgglvvdli...............................
00405882   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00457851   1/1  GKtTlakaLaerlglpvistddllre.........avpggtrlgeviqdlfllggllffdeldel.....
00475522   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00410321   1/1  KTTllnrllggefp--------------------------------------------------------
00478391   1/1  GKtTlaralaerl..........glpvidgddllrelvgeggrlgrdlfdedrllfrellideidl....
00496061   1/1  KtTlaklLaerlglpvistddllre........evepggtdlgeifqalllagel.lfddevlgllrerl
00409841   1/1  KSTLlnaLlgadlaivsdipgttrdpilgv........................................
00368572   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00418301   1/1  irpgknvlLvGppGtGKTtlaralakll..........grpfirvdaselte..aelvGyesgarlrelf
00368502   2/2  ----------------------------------------------------------------------
00489391   1/1  KtTlakaLaerlglpvistddllr.........eavpggtdlgelfqdlllegellfideia........
00401211   1/1  KSTLlnaLlgll..........................................................
00434402   2/2  ----------------------------------------------------------------------
00430121   1/1  KTtlakalagllfp........................................................
00477561   1/1  GKtTlaraLakrlaelgkgvvvidtddlrr........................................
00482721   1/1  GKsTlarlLaelglpvidtddlyrel...........vaggtplgerirellgegyllpdealfrallae
00482661   1/1  lildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlelleki
00532532   2/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00493171   1/1  GKsTlaklLaekl..........glivlsvgdttrepregevdgvdyvfvsgelfkelidagelled...
00495771   1/1  KStLlNaLlgellattgeipgdg-----------------------------------------------
00487061   1/1  pGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllr...........................
00484102   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALMQDPQFLILDEPTAVLTPAEADRLFDVLEQL
00390411   1/2  llgnpeillngepvnhldlrelllnllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsll
00379581   1/2  llllllllalskaearervlellelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLD
00475891   1/2  eaalralllllllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellre
00422801   1/2  lglskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetra
00378981   1/2  skaeaaaraaellellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellel
00404101   1/2  kaeararalellellgldelldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetr
00361211   1/2  ....rarellerlglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvae
00500441   1/2  eaaeralelllllgledlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellre
00482201   1/2  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraell
00458601   1/2  lllllllllllaakeaalralllllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgL
00466971   1/2  llllaakeaalrlellllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetrae
00475991   1/2  lllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetrael
00440861   1/2  dtklsdeeklilkyleeadlvllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllksln
00420701   1/2  lskaeararalellellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraelle
00482261   1/2  lllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetrael
00466931   1/2  rlllelllgrlelllllllllellallldlllllllllllllllllllvlllllllllvlllllllalll
00502741   1/2  eaaaraaellellgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellre
00530591   1/2  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraell
00490801   1/2  lgglvlqdvllffltll..........lllaakeaalralllllllgletlldrrpseLSgGqrqRvalA
00510251   1/2  lspqelrrlgglvlqdvllffltll..........lllaakeaalraellllllgletlldrrpseLSgG
00436071   1/2  alaralellellglgdl.drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrel
00425571   1/2  eaaaralellellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellre
00367901   1/2  idgkdislldlrelrr.ligyvpqdpalfpqltvlenlllglelrrklldellgllellalleellklle
00509431   1/2  rlilkpgsgeilingkdislldlrelrr.ligyvpqdpnllfqltvlenlllgpeerrelldellglell
00488521   1/2  ...gedveellerlgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsa
00436511   1/2  dpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftlls
00496111   1/2  .......................drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndp
00495371   1/2  lld..rerviellelvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilr
00372301   1/2  .......llervgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallel
00485451   1/2  dlglll.....eilervlellelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDp
00469451   1/2  ...........aeellelvgledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpe
00468691   1/2  relr.rrigyvfqdpalfpeltvlenlalgallag...............lglaeyldelgkdLSgGqrq
00498251   1/2  ......................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellel
00379601   1/2  ..................................laralrqdPdilllDEptsalda.......ellqal
00424961   1/2  rdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveg
00500611   1/2  ................arerviellelvgllelldrlprelkrsggqrqrvviDaralllrpe.l.lDEp
00503371   1/2  lgdeliirrrilrdgrseyllnglgvs..lkeliellldlsggelnrvalllqgevdlllldepterldf
00437981   1/2  veevrellkel................lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlkll
00485931   1/2  laeraeellellglegfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..
00468601   1/2  aagydvvlidtaglld.ldrlvgelsggqkqrvaiarala.apevllldeptsglda..laellelleel
00422141   1/2  stlpdigglslvirklreviltledlglsygdpealkdlslaippgglvlltGptGsGKtTllralagll
00367481   1/2  ........................rvdeiltrvglsdlldrgls.lsggerqrvalaralatdpslllLD
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00381441   1/2  lglllalllaleegkivildgdreraeellellgldadlviilpasleellerldrrggelsggqkqRva
00371631   1/2  q.kglpealdveellellldlkegle...................dilvpvlsggqkqrlalaralvedp
00414121   1/2  l.........................lredpdlilidsgGqkqrlalaralladpdlgellllDeptlvl
00448931   1/2  leararellellgledydvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..
00464791   1/2  vrellglllelgvlf.............................aaellervglvaatadeppgelsggq
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00532531   1/2  lvdeedleraenllalvgleeipnrypselsgGqqqrv...........illldEPtsgLdpvsr.....
00458602   2/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00457311   1/2  lklgkk.......llepvglpevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.
00495031   1/2  ..gldldellerllvidllelvgllelldrlprelsggqrqrvviDalalllrpell..Deptsaldvql
00475371   1/2  arellgllgellgldvlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldll
00390412   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00478411   1/2  aeieervdlllelvglddlldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellelll
00512891   1/2  .........vrgeleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleel
00361212   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00480471   1/2  ltltvaenlllgldllllellkelkydpvilllnkidllddrllrraeaeerieel--------------
00368501   1/2  eeaigyvfqdpalfpg.tvlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrel
00466932   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00379961   1/2  nfaalpasllesel............lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevq
00426051   1/2  dlgllirgdeeleaalelaglprvielllegldtlag..gggvvlsGgqrqrvalar.....pdlllfld
00387201   1/2  egigyvfqdpalfp--------------------------------------------------------
00477971   1/2  tsrerveellea.gldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleell
00475521   1/2  aealarvdellelvglddellldrlp.sggqqqeilrvaiallilpvllgralallpelllldeptsald
00440862   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00462761   1/2  ivivdgtlllvglrealrkll....gllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleel
00489571   1/2  ...............................lallelrntteagaasgsrdkgllgklkpetraelldll
00437941   1/2  .......................pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklle
00515531   1/2  lelrrwigrlfqdlnlfpsltvlenl........anvpillvlnKiDlleakeraeellellglgdlldk
00368571   1/2  ellralvsemgrgeddfftpaarallralilalaeepeptldellellselglrdladrle........k
00496571   1/2  laalaagvgvvldrvglsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl..
00488522   2/2  ----------------------------------------------------------------------
00503741   1/2  lldl.......................kellrlllealglpppyq.....lsggerlrvalaeallalgk
00498252   2/2  ----------------------------------------------------------------------
00475381   1/2  ......................llgglvvildggvrqrlalarallldpdvllldeplllldaalr....
00515511   1/2  lalrrwigrlfqslnllesllvlenlanvpillvlnKiDlleaklvlll.lvglfdlldglpselsggqk
00533501   1/2  vlrglikpalaegvsvildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRl
00379261   1/2  rllvfltvlenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirv
00434401   1/2  drellreevlellglgevvivdvydlsggerqr...aralasgpdvlilDgptlgldv............
00464411   1/1  kealaegvivildrvgl..sdlaypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg.rl
00469452   2/2  ----------------------------------------------------------------------
00487021   1/2  rgllkaerlervevllervgl..lldrippalsgGqgqrvildrallselayqpdvllldeplsgldakl
00490731   1/2  adellgvlaeelgldvllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkel
00468951   1/2  teesldqlr...arrlgldlddllllpaltveellala..............................er
00510561   1/2  sleql...rarrlgldldrlllldaltv.............eellalaerll.................s
00372302   2/2  ----------------------------------------------------------------------
00484101   1/2  eeleralelle.lagfdvilieGllelalplilelrelsdgqiqrvaparallrdpllllldedtvvldk
00485932   2/2  ----------------------------------------------------------------------
00493431   1/2  tskerveealekgllvlldr....dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkr
00405881   1/2  lgeglvrqalealeradvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptnel
00495372   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00356411   1/2  ldkwrnrlgevlqllelilnltvlenvpiilvlNKiDlleekiveellellgleykgdrdpeelsggqkq
00437982   2/2  ----------------------------------------------------------------------
00498531   1/2  sleql...rarrlgldldellllpaltveellala..............................erlls
00468692   2/2  ----------------------------------------------------------------------
00478441   1/2  aealkrvdlvlelvgld...drypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlil
00485452   2/2  ----------------------------------------------------------------------
00451571   1/2  viellrealeeldadgvildgfprllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeq
00448932   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00404191   1/2  .........................delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqe
00439861   1/2  lgllsiliad.................................plglsgeellrvllalalelkpdllii
00498811   1/2  alglalegvildalrrrllelldllgldvvilegplllsgglrqrpdlvifldappevlleRllkRggld
00470731   1/2  qvaregglvpdilfideidallrkgpdvildgagrtpeqlealldlleelgrpvvviilttnrevlldra
00367482   2/2  ----------------------------------------------------------------------
00477011   1/1  elgerldllglvfqdfsllpelielenrala...gpiagisrdairleielpglpdltlvDtPGlgsvav
00500612   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00532471   1/2  .................rleellerippa..lsggqgqrvildrslysrpavlllllyvdeplsgldvel
00394721   1/2  .............vrldlsellsvsdlvgelegglrgllteala.lakpsvlflDEidrlldardsessl
00495032   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00406781   1/2  ........sellg......kyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssr
00402371   1/1  .................fgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqna
00503372   2/2  ----------------------------------------------------------------------
00432181   1/2  .........................vliDtpGleefasggekqrvalalallreadvlllvvdadeptsf
00475372   2/2  ----------------------------------------------------------------------
00508671   1/1  agrlvvldgtalglelrdelrellkeaglpllvvfldaplevlleRdrrglypeelsgglkqrvaiarpl
00464792   2/2  ----------------------------------------------------------------------
00392701   1/2  .........................llgkyvgelsgglrqr..larallakpsvlllDEidklapkrspt
00513251   1/2  ..............................gqkqrvalleaalkegylvvvDet..gldraqrlellela
00379962   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00489631   1/2  ...................ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkR
00499331   1/1  ........rrlllealdelllaggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrg
00444381   1/1  ...gvpfiridgselte..kelvGe.............................................
00480441   1/2  lygtskerieealda.glgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkr
00499191   1/1  aldrelllelllalveglvvlldryprllsggqrqrvaia.....dpdvlildgptllldpelrpladlv
00515351   1/1  ..rglllealeellaagkvvild......glsggllqrvallrallrpdlvifld---------------
00512892   2/2  ----------------------------------------------------------------------
00367291   1/1  .................................lleklvgegegrlrgalaealradpgvlflDEidala
00513761   1/1  eellttldillealell.eedydyiliDtpGglelrallalllaiaral.aadeillvddptsgldaetq
00386741   1/2  pfvrldaselsg.................geklrgllarala.kpgvlllDEida.ldpdvqeallelle
00461621   1/1  lldgfprtleqaeals........kpavlsggrkqrlalaralavdpe.lildgrllgr...rllplpdl
00371632   2/2  ----------------------------------------------------------------------
00533151   1/1  llerleellargpvvildgf.............pggllqrealrrlllrpdlvifldapleelleRllkr
00473941   1/1  ................pfielsasdllgesdlrggfkqa........akpgvlflDEidrl.drevqnaL
00437921   1/2  .........sdlrgvddlreligevlqalglllgg.......................kpdvlllDEi.d
00420941   1/2  ........sellg......kyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrr
00521551   1/1  .......................elvg......kyvgelegglrqllalaraa..npgvlflDEidklap
00437942   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00517691   1/1  gtlllllgllsfllalvldslplerergitidvalarllldgrkilllDtP-------------------
00478412   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00469161   1/1  likellaagkgvildrfp....lsrlayqlsggerqrlaidlegalllerllldepfpdlvifldaspee
00437901   1/2  ..............vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallk
00476071   1/1  dealdrellaallfglel.egalldglvygvlqdrllerllaagpdvlildgpl.lldvell.plpdlvi
00457312   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00527261   1/1  ...................ellkkllkklsellglsilglelilglsggdleelleelaellkklgkpvi
00387202   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00478081   1/1  lrreairelllgldlleilfeglllsdefrelleealalladgdvvilDgfgrlldarq..lleelllll
00404192   2/2  ----------------------------------------------------------------------
00472911   1/2  ....................gllfedaleagfrqrladlirallakgkvvild..gtglsreareellel
00480472   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00410531   1/2  ....................viwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellgl
00480251   1/2  llegydvvliDtag..............glqrglllalaladlllvllldepllvldatagtellelakg
00511381   1/1  .........................................qdpdviliDE.aqfldp....evvevlle
00416171   1/1  ..........dlleselfghekgafgggekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvlee-
00482551   1/2  fsperlreralslgldleelldrllvidatdlldllellerlrrllsegkvdlvviDslallarael..l
00519581   1/1  ............................dleaverhlldiaeellengeilildeptvgldskd...ild
00405882   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00457851   1/1  ....lkerieellaaggvild..gfpldlegaealreallragplpdlvifldapleelleRllkrgrep
00475522   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00478391   1/1  ............................................llakgkvvildgtn..lsealdealr
00496061   1/1  delielllaggvvildgf.........pldlegalllrealarallpdl.vifldapleelleRllkrgr
00409841   1/1  .....................................vlldgrdllllDtPGlidfaseptnlldleiie
00368572   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00418301   1/1  ..............................................aragigllaladpgvlflDEidkl
00368502   2/2  ----------------------------------------------------------------------
00489391   1/1  .elllealae.................................aegkvvildgtg..ldieqrealrell
00401211   1/1  .................ldtlkgelergitikigaasllldklaivsdtpgttldpilgvleldgpklll
00434402   2/2  ----------------------------------------------------------------------
00430121   1/1  .................sgvpfirinlseltekllvselighppgyvGedelgvlfeaarkappsvlllD
00477561   1/1  ...........alifqdeldlfdedree.gfrvpeelvrellkellarllaeggdvvilDgt..nltleq
00482721   1/1  llfgdllalalldgvvydrlrdellaelsggqgdvliiegalllepgllplpdlvifldappevlleRll
00482661   1/1  ieellrirldklledldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyG
00532532   2/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00493171   1/1  aivigllyergtlldavegalld...gfpvlldgalqlllllrelllkpdl-------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  lirelllrlgfgepdafdnellgellealleg...............gki.vlsarraqlleirlirpll
00484102   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RADGRALLYISHKLEEVKRLCDTATILRAGRVVAACNPRAETAASLARMMVGVDVIPPKPQPGHSIGAPR
00390411   1/2  keklkelnallkelelqlkelarllelleglke-------------------------------------
00379581   1/2  petraellellrelakegltvllvthdldealrladrilv------------------------------
00475891   1/2  lakegltvllvthdldealrladrilvlddGrivelgtpeellen-------------------------
00422801   1/2  ellellrelak.gltvllvthdlsla.aladrilvlddGr------------------------------
00378981   1/2  lrelakelgltvllvthdlsealrladrilvlddGrivel------------------------------
00404101   1/2  aellellrelakegltvllvthdldealrladrilvlddGrivelgtpeelle-----------------
00361211   1/2  llellkelakelgvtvilvthdldlldsallrpgkrpllsdl----------------------------
00500441   1/2  lakelgltvllvthdlsealrladrilvlddGrivelgtp------------------------------
00482201   1/2  ellrelak.gltvllvthdlsea.rladrilvlddGrive------------------------------
00458601   1/2  DpetraellellrelakegltvllvtHdldealrladrilvlddGriveegtpeellenplll-------
00466971   1/2  llellrelakegltvllvthdldealrladrilvlddGriv-----------------------------
00475991   1/2  lellrelakegltvllvtHdlsealrladrilvlddGriv------------------------------
00440861   1/2  kelglkelrrgigyvfqdpnlfpglvvlisaltgegldeltvrenlalglr-------------------
00420701   1/2  llrelakelgltvllvthdlsealrladrilvlddGrive------------------------------
00482261   1/2  lellrelak.gltvllvthdlseal.ladrilvlddGriv------------------------------
00466931   1/2  llalkeaallleelllllglgdlldrpvstLSGGerqrva------------------------------
00502741   1/2  lakegltvllvthdldealrladrilvlddGrivelgtpe------------------------------
00530591   1/2  ellrelak.gltvllvtHdlseal.ladrilvlddGrive------------------------------
00490801   1/2  rallldpdlllLDEPtsgLDpetraellellrelakegkt------------------------------
00510251   1/2  qrqRvalArallldpdllllDEPtsgLDpetraellellr------------------------------
00436071   1/2  aeelgltvllvthdldlalaladrivvl------------------------------------------
00425571   1/2  lakelgltvllvthdlsealaladrilvlddGrivelgtp------------------------------
00367901   1/2  ellkelevleaalaallkeeieeraeellellglgglldr------------------------------
00509431   1/2  sleealaraeealeelnallkeleeeleligplldglellvglnglldrplselS---------------
00488521   1/2  ldvsllrellrlLkrlakelgvtvllvthdldevar----------------------------------
00436511   1/2  rlderagnlSgGqrqrvaiara------------------------------------------------
00496111   1/2  elraellrllkrlkelgvtvilvthdleeaedladsgria------------------------------
00495371   1/2  lLkrlakelgvtvllvthdleeveeladrvavlagg----------------------------------
00372301   1/2  laelgatvlfvtHdlelaalladrvvvlndgrivavgtp-------------------------------
00485451   1/2  etralelldllrtdldkelgrtiilvthdlreae..adrilvlrkgdivelgep----------------
00469451   1/2  traeilrlLkelakelgvtvilvtH.......As------------------------------------
00468691   1/2  rvalAr.....pvlLllDEptsgldalre..ilellrellkel---------------------------
00498251   1/2  lrrllrlakelgvtvllvthdldeaealadrvlvla----------------------------------
00379601   1/2  lt.ghtvvlvthhlntaldladriivlddGriveegtpeellanplasaldlvvaqrlvrdldgrc----
00424961   1/2  gsdpdllllDeptsalDgeivlslllalkrlyPaidvllS------------------------------
00500611   1/2  tsaldvslraeilrlLkrlakelgvtvllvthdlrevee-------------------------------
00503371   1/2  ldelagleeykgnyeellklleeleellkelekrl-----------------------------------
00437981   1/2  eelak.gvtvilathdlsellpallsrcqvir--------------------------------------
00485931   1/2  lrlllellkel...gltvlvvthddgtakggaalslaleladr---------------------------
00468601   1/2  ...gltvlvvtKlDgtakgghdlslalrladrilvlgv--------------------------------
00422141   1/2  npdegriltiedp.............ieyvfqspnlfpl..-----------------------------
00367481   1/2  EptsgldpedgaalaeallellaellgatvlvvtHdlelaal----------------------------
00422802   2/2  -------------------------------------------------llllllallllllllllldpl
00379582   2/2  ------------------------------------------------------------------lepl
00381441   1/2  l---------------------------------------------------------------------
00371631   1/2  dvlilDgptalldpltr.ellellkelrdlldltilvda-------------------------------
00414121   1/2  DaasgedlldllkelaeqlgltvlivlnKiDllselthdlel----------------------------
00448931   1/2  lrellellrel...gltvlvvthlDllakggadlslale-------------------------------
00464791   1/2  rqrlaiAraladdqgkpvllllDEptsgldal.reillllgellseegy---------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00532531   1/2  ......................leladriyvllsGrives------------------------------
00458602   2/2  ----------------------------------------------------------------------
00420702   2/2  -------------------------------------------------------------------lpl
00378982   2/2  -------------------------------------------------------------------lpl
00457311   1/2  elldllifldadlgltlirlitrdlgeagrsadrvl....g-----------------------------
00495031   1/2  vaeilrlLkrlakelgvtvilvthdlrevegrleladrv-------------------------------
00475371   1/2  relradlgllvvdathdldavlkaadrilvldlg------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00482202   2/2  ---------------------------------------------------------------------l
00404102   2/2  ----------------------------------------------------------------------
00475892   2/2  ------------------------------------------------------------------llle
00466972   2/2  -------------------------------------------------------------------lla
00530592   2/2  ----------------------------------------------------llllllaleelpllgell
00425572   2/2  ----------------------------------------------------------------------
00478411   1/2  glneeldiilalelllld----------------------------------------------------
00512891   1/2  krsgvtvilttndldel.eladriallrrgrivelgplseeelleilrrrln------------------
00361212   2/2  -------------------------------------------------------------plellgepl
00482262   2/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00368501   1/2  erevlldlplhdasviallgggrelrdgellkalkeaeae------------------------------
00466932   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------lllaaelpelge
00500442   2/2  ------------------------------------------------------------------llle
00367902   2/2  ----------------------------------------------------------------------
00436072   2/2  --------------------------------------------------------------------pl
00502742   2/2  ----------------------------------------------------------------------
00379961   1/2  aaLlrlleegevtieragitlllpagvtviaa--------------------------------------
00426051   1/2  eptselleRllkrltrpgldadteeellelle--------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00477971   1/2  elae.gfdvvivnhdleealelldrilvl-----------------------------------------
00475521   1/2  pdl-------------------------------------------------------------------
00440862   2/2  ------------------------------------------------------------Mpllslgepl
00509432   2/2  ----------------------------------------------------------------------
00462761   1/2  lerleereplygadiviithdls.ieevadrilallegrl------------------------------
00489571   1/2  re...egttilvvth.ldeaer.aDrvavlddGtpe----------------------------------
00437941   1/2  elpk.gvtvilttnrleeldpallsRfdviefpppdeee-------------------------------
00515531   1/2  lpselsg---------------------------------------------------------------
00368571   1/2  lvagglagllegaektaasilellrkllal----------------------------------------
00496571   1/2  ......rlgdteevlehrleraeeladrlialyegavvv-------------------------------
00488522   2/2  ------------------------------------------------------------lllllalell
00503741   1/2  pdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltliltthdldllerl-------------
00498252   2/2  ---------------------------------------vekllglalllieklflkvlprl.....lsl
00475381   1/2  .......dlpdlvifldad---------------------------------------------------
00515511   1/2  qrva------------------------------------------------------------------
00533501   1/2  rkrgrlelreldseevlekrlehylell------------------------------------------
00379261   1/2  lllsaslvlllgglglpevgelllelld------------------------------------------
00434401   1/2  lldlpdlvifvdhdlevalerrlkrlg-------------------------------------------
00464411   1/1  lek...leyikkrlehylelaepykddvvvidangsieevvee---------------------------
00469452   2/2  --------------------------------------------------------------------al
00487021   1/2  reelrdllrellpegilpd---------------------------------------------------
00490731   1/2  laelgadvvllvvdatlgleaadrilvlleglg-------------------------------------
00468951   1/2  llsggkpqlvviDsltalrpalllldeptgellg------------------------------------
00510561   1/2  ggkvdlvviDsltalapalelsllldeptsglda------------------------------------
00372302   2/2  ----------------------------------------------------------yvlPllsdgmpl
00484101   1/2  vdlasildllle----------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00493431   1/2  lkrlleelgplieydyvivnddleealeelldiivvlllglilqpgsl----------------------
00405881   1/2  .......dlellelleelggtvvlvSahdgegldelldaile----------------------------
00495372   2/2  ----------------------------------------------------------------------
00424962   2/2  --------------------------------------------------lgepldglgplr...papgl
00436512   2/2  -------------------------------------ievpvglallgrvldllgepidgkgplelgepl
00496112   2/2  ----------------------------------------------------------------------
00356411   1/2  rvalaralakdp----------------------------------------------------------
00437982   2/2  ------------------------------------------------------------------lvek
00498531   1/2  ggkpdlvviDsltalapslllldepgrvtqglda------------------------------------
00468692   2/2  -----------------------------------------------------lsvpvglallgrvldvl
00478441   1/2  kll..gidallelvdr------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00451571   1/2  kqrvaiarallk----------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00404191   1/2  ellelldelaergvtlilttnnrpeeldq-----------------------------------------
00439861   1/2  Deltalldaervrelrellralkrlakelgv---------------------------------------
00498811   1/2  eetiekrlelylelaplygaadividnd.l----------------------------------------
00470731   1/2  l.rRpgrllldep..eldppdr------------------------------------------------
00367482   2/2  ------------------------------------------------------yvrPelldep.....l
00477011   1/1  vdqlsggqkqrva---------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00532471   1/2  reelrdlleslllvlplpd---------------------------------------------------
00394721   1/2  evlnaLlrlledgnvlviattnrpellgrleldpallrrfdvielgpp----------------------
00495032   2/2  ----------------------------------------------------------------------
00422142   2/2  ---------------------------------------------------------------------d
00406781   1/2  rvlnaLlrlleelrllsgvtviattndlee----------------------------------------
00402371   1/1  Llrlleeg...nvrviaatnrpelvklgeldpallrRfdvielplpdleerl------------------
00503372   2/2  ------------------------------------------------------------------ekrl
00432181   1/2  ldle....llellrelllagkpvilvlnKiDlldar.eelakllgvpvvevSaktgegv-----------
00475372   2/2  ----------------------------------------------------------------------
00508671   1/1  elaaepdl--------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00392701   1/2  sgldvelrrrvlnaLlrlleglr....................llsgvtv--------------------
00513251   1/2  rdlgrpvlviflatspevlierlldrvlllde--------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00489631   1/2  dgrteeeilerlarleery..radlvivt-----------------------------------------
00499331   1/1  rldgreddslellekrleryeeltrdlielyeeadrvividagls-------------------------
00444381   1/1  .segailsggfkqrvgia..lladpgilflDEi-------------------------------------
00480441   1/2  lerlapeleyyeelgladvvivnddleealelll------------------------------------
00499191   1/1  ifldaspeelle.RllkRgrlergddleevlerilervr-------------------------------
00515351   1/1  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00367291   1/1  gkrgsgtsrldpevqnaLlrlleelrv.......................--------------------
00513761   1/1  leilelllelllklgipiilvlnKlDllseeg--------------------------------------
00386741   1/2  egeltivgggllteldglllpsgvlviattnrpel....ldpallsRfdlvi------------------
00461621   1/1  vif-------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00533151   1/1  grlirleddseevlekrleryl------------------------------------------------
00473941   1/1  lelleelqvtilggglvvvelllllpsgvlviaatnrpel....ldpallsR------------------
00437921   1/2  rldpdaqnallklle-------------------------------------------------------
00420941   1/2  evlnaLlrlldglqalsnvtviattnrpeel---------------------------------------
00521551   1/1  krsptsglddvsrrrvlnaLlrllegle....................dl--------------------
00437942   2/2  ---------------------------------------------------------------lrplvek
00503742   2/2  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00469161   1/1  ll--------------------------------------------------------------------
00437901   1/2  lldglrdlsgvliil-------------------------------------------------------
00476071   1/1  fld-------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00527261   1/1  lilDEiqsll------------------------------------------------------------
00387202   2/2  ---------------------------------------------------------------mssgepl
00439862   2/2  ----------------------------------------------------------------------
00478081   1/1  leepppdlvifldadpevlleRllkRgrre----------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00472911   1/2  lkelg..pvlvifldadpe---------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00410531   1/2  aglegvpiilvgnKlDll----------------------------------------------------
00480251   1/2  llealgldg..vvltkldlvaalgaalsvalilglp----------------------------------
00511381   1/1  ladtgilvlvtglemdfagelfegsllL------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00482551   1/2  depllgldarelrellrlLkrlakelgvtviltsql----------------------------------
00519581   1/1  elakilkevnfelifithd---------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00457851   1/1  lddteevilkrlerlrelyerl------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00478391   1/1  rllr.....pdlvifldap---------------------------------------------------
00496061   1/1  llereddseevlekrlerylelyerlie------------------------------------------
00409841   1/1  allraleeadvvllvvdadrglleqdlellelllelgk................................
00368572   2/2  ---------------------------------------------------llgvrllpplppklagllp
00515532   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00418301   1/1  lpargssggdvsredvlnaLlrlleegeltilggg...--------------------------------
00368502   2/2  ----------------------------------------------------------------------
00489391   1/1  lel.prpdlvifldadpee---------------------------------------------------
00401211   1/1  lDtPGhe......dflkellralaladgallvvdadegeflpqtlevlllllelgvk.............
00434402   2/2  ----------------------------------------------------------------------
00430121   1/1  Eidkl.....dpdvlnaLlqlleege...........vtdlggrvvdlsn--------------------
00477561   1/1  realrrllkelgrpd.lviy--------------------------------------------------
00482721   1/1  kRg...gdseeeiekrler---------------------------------------------------
00482661   1/1  PpGtGKTtlakalanel..........ggpvi................----------------------
00532532   2/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  aegkvvilDre-----------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00420942   2/2  ---------------------------------------------------------lrpvllddvigqe
00472912   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00394722   2/2  ---------------------------------------------------------lvslleslelpll
00410532   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LVVNGLSLAPDDPHGVTLKQIDLQLRGGEIVGIAGVAGNGQDELFAALSGEAPLDEARTILIDGQAAGDL
00390411   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00422802   2/2  lelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllk.ptsGeilldgldilal
00379582   2/2  levenlsksy..ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllk.ptsGeilldgldital
00381441   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00490802   2/2  llllllllalllelleeeeellllllalllllgdpllelenlsksy..ggvpalkdvsltikpGeivalv
00510252   2/2  lllllllllaeellelleeeelllllllllllllgdpllelenlsksy..ggvpalkdvsltikpGeiva
00532531   1/2  ----------------------------------------------------------------------
00458602   2/2  lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt.sGeilldgkditgl
00420702   2/2  lelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkpt.sGeilldgldllll
00378982   2/2  lelenlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkp.tsGeilldgldllll
00457311   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00390412   2/2  ---------------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglr
00482202   2/2  lllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt.sGeilldgkdilgl
00404102   2/2  --elenlsksygg..vlalkdvsltvepgeivalvGpnGaGKSTllkllagll..ptsGeilldgldlta
00475892   2/2  lllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt.sGeilldgkdilgl
00466972   2/2  lllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt.sGeilldgkdilgl
00530592   2/2  levknlsksyggvl..alkdvsltikpgeivalvGpnGsGKSTllkllagllk.ptsGeilldgkditdl
00425572   2/2  lelenlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkp.tsGeilldgldllal
00478411   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00361212   2/2  lelenlsksyg..gitalddvslgirkGeivllvGpsGsGKStllrnllagllapt.ggsvlldgleisa
00482262   2/2  lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt.sGeilldgkdildl
00480471   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00466932   2/2  ---------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpd.sGe
00475992   2/2  lllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllk.ptsGeilldgkdildl
00500442   2/2  lllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkpt.sGeilldgkdildl
00367902   2/2  lelknlslsyg...ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlil
00436072   2/2  lelenlsksygg...lalkdvsltvepgeivalvGpnGaGKsTllkllagllk.ptsgeilldgldlla.
00502742   2/2  lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt.sGeilldgkdilgl
00379961   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00440862   2/2  lelenlsksy..ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlg
00509432   2/2  Mlelknlslsnfr....vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsd
00462761   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00488522   2/2  levenlristgike..ldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.........
00503741   1/2  ----------------------------------------------------------------------
00498252   2/2  lelenlskiy...tgipaldvslglgGlppGeivlllGpsGsGKTtLalrllagllkpg.ggvvyidgee
00475381   1/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00469452   2/2  lelenlskiyggvp.kalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvl
00487021   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00372302   2/2  lelenlrkpy..ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpa.sggilvdgedlr..
00484101   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi....
00493431   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalr
00424962   2/2  lelenvsksy..gtgialidlslpigkGervalvGpsGaGKttLlrliaglldpd.sgeilldgvdiger
00436512   2/2  levenlsksyggrklvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpd.sGeilv
00496112   2/2  --elenltklytg..ikaLddllslgippGeivllvGpsGsGKTtlalrllagllkp.tggkvliiglel
00356411   1/2  ----------------------------------------------------------------------
00437982   2/2  lrpknldkvi..gqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi.
00498531   1/2  ----------------------------------------------------------------------
00468692   2/2  gepidglgplllllllpivrlappllelenlsksy..gtgialidvsltigrGervglvGpnGaGKttLl
00478441   1/2  ----------------------------------------------------------------------
00485452   2/2  -------------skiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkplllt
00451571   1/2  ----------------------------------------------------------------------
00448932   2/2  -----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadia.rl
00468602   2/2  -------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraa
00404191   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00367482   2/2  lelengrhPllsksyg..gkvvlndislsip.gellvitGPngsGKSTllralaglllpa.sggilvpge
00477011   1/1  ----------------------------------------------------------------------
00500612   2/2  ----------------pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtl
00379602   2/2  llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvldlls
00532471   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00495032   2/2  -----------------lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllq
00422142   2/2  lsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifldee
00406781   1/2  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00503372   2/2  laleklsklfneilkellkggslelelerlgerlalvglngsgkdtllk.....................
00432181   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi....
00508671   1/1  ----------------------------------------------------------------------
00464792   2/2  --------------lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi
00392701   1/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00379962   2/2  --yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsg.rivlvgnlsd
00414122   2/2  -------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdf.geili
00381442   2/2  ---------------------------GeliaivGpsGsGKsTLlklLagllppd.sgsigslttrlprl
00489631   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00512892   2/2  ----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv....
00367291   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00371632   2/2  ---------------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsr
00533151   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437942   2/2  lrpknlddvy..gqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsg.gvrvlgidas
00503742   2/2  -fifldlrplallplpdrlvgrdeeiealskalgg....aldgvslsiepggivllvGppGvGKTtLakl
00517691   1/1  ----------------------------------------------------------------------
00478412   2/2  -------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl......Gtilldg.dlvr
00490732   2/2  -------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpa
00469161   1/1  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457312   2/2  -------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyk
00426052   2/2  -------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlg
00527261   1/1  ----------------------------------------------------------------------
00387202   2/2  levenlskry..ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvreye
00439862   2/2  --------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisl
00478081   1/1  ----------------------------------------------------------------------
00404192   2/2  -----------------lellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa......
00472911   1/2  ----------------------------------------------------------------------
00480472   2/2  ---------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeil
00462762   2/2  -----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr
00410531   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00405882   2/2  ---------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvv
00510562   2/2  -----------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGg
00498532   2/2  -----------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGg
00457851   1/1  ----------------------------------------------------------------------
00475522   2/2  --------------evlalhgvsldve.gevvllvGpsGsGKStllralag......sGeilvd....gd
00468952   2/2  -----------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllg
00487022   2/2  ----------------------------rmkiivltGpsGsGKsTlarlLaell.....gvvvidtddll
00489572   2/2  -rvknlsksyggkta..lddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt...............
00410321   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00409841   1/1  ................pvilvlNKiDlldaeellleevleellkllaelggvpvvpi-------------
00368572   2/2  lagladgdglgvllGklldgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkge
00515532   2/2  --------------------------kgekvallGlsgsGKSTllnrllglefaygpTigpts.gtieid
00477972   2/2  -------------------------hkgelvvlvGPsGaGKsTLlnaLlgllp..tsgvisvsgttr.pp
00418301   1/1  ----------------------------------------------------------------------
00368502   2/2  ----------------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvl
00489391   1/1  ----------------------------------------------------------------------
00401211   1/1  .....................piilvlNKiDlvdaelleevleeleellkllg-----------------
00434402   2/2  ---------------lalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrp
00430121   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00532532   2/2  --------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipd.dgeilidggdinle
00451572   2/2  ----------------------MsikkgeiiaivGppGsGKsTlaklLakll.....glivldgddl...
00493171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00484102   2/2  ---------------------------kgpvigivGpsGsGKTTllraLagllkpr.ggrvavigldigr
00406782   2/2  -----------------lkdlslgippgknvllvGppGtGKTtlakalagel...gvpfvrisase....
00478442   2/2  -------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl......Gailvdd.dlvl
00437922   2/2  -------------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlarala
00532472   2/2  --------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvge
00392702   2/2  -----------------ledlslgirpgknvlLvGppGvGKTtlaralagll...gapfgrvdasd....
00533502   2/2  ---------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigt
00379262   2/2  -----------------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvl
00480252   2/2  -------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr.
00482552   2/2  -----------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplel
00475382   2/2  ---------------------------mkgeiialtGpsGsGKsTlarlLagllk.ptsgivsvdglrla
00493432   2/2  ---------------------------kGelivllGpsGaGKsTllkllagllgptsgvis......vgg
00432182   2/2  ---------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdyp..........
00515512   2/2  --------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigpte.gtieid
00498812   2/2  ---------------------------kPgkiigltGpsGsGKsTlarlLae.l.....gvividgddlt
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  -----------------lkavllgirpgehllLvGppGtGKTtlaralagel...gapfvrlda......
00470732   2/2  ---------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTla
00513252   2/2  --------------iellsdlslsipspevvllvGppGsGKstlakklaell.....gfilidaddlr..
00437902   2/2  --------------------lslgirpgrillLyGppGvGKTtlakalakel...gapvieidaselrd.
00420942   2/2  eakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel...gapfiridg......
00472912   2/2  ---------------------------mkmkkgklilltGppGsGKtTlaraLaell...........ga
00489632   2/2  ---------------------------MkgklillvGppGsGKtTlaraLaellglpf...iridgddll
00480442   2/2  ----------------------------------------------------------------------
00496572   2/2  --------------------------GkgelivllGpsGsGKsTlarlLagll....ggsvldtgepirg
00394722   2/2  eklrpvllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvr
00410532   2/2  ---------------gelknlslelkkglkillvGlngvGKTtllkrlaggefvdygptigvn-------


                         -         -         -         -         *         -         -:420
query           SITARRRFGAAFIPEQRLGHATVPTMRLSENALLTSHADPGVVRRGFVDRAALLGLVDRVTAAFGVRKAQ
00390411   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00422802   2/2  slaelrr.rigyvfqdp...alfp.ltvrenlalgllla...llllglskaeararalellellplgldt
00379582   2/2  slaelrrrgigyvfqdp...alfpgltvrenlalglllllllllllllllllalskaearervlellelv
00381441   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00490802   2/2  GpnGsGKSTLlkllagllk.ptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00510252   2/2  lvGpnGsGKSTLlkllagllk.ptsGeilidgkditglspqelrrlgglvlqdvllffltll........
00532531   1/2  ----------------------------------------------------------------------
00458602   2/2  spqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgl
00420702   2/2  slaellalrrgigyvfqdp...alfpgltvrenlalglllag.......lskaeararalellellgldd
00378982   2/2  slaelllllrrgigyvfqdp...alfpgltvrenlalglllag.......lskaeaaaraaellellgld
00457311   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00390412   2/2  vgklsdlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlre
00482202   2/2  slkelrgigyvvqqdallpsltvlenl........llgllllgllllllaakeaalralllllllgletl
00404102   2/2  lslael.rrgigyvfqdp...alfpgltvrenlalgll............kaeararalellellgld.e
00475892   2/2  sllellrrgigyvfqdpa...lfpgltvlenlllglll........lglalkeaalralllllllgletl
00466972   2/2  slaelllllrrgigyvfqdpalfpgltvlenlllgll....llglllllaakeaalrlellllllgletl
00530592   2/2  slkelrgigyvvqqdallpsltvlenl........llgllllgllllllaakeaalralllllllgletl
00425572   2/2  sl...lrrrigyvfqdp...alfpgltvrenlalgllll.......glskaeaaaralellellgldd.l
00478411   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00361212   2/2  lslaerlragigyvfqdl...alfpeltvlenlalg....................rarellerlglail
00482262   2/2  slaelrgigyvfqqdallpsltvlenlllgllllgellll.......llaakeaalralllllllgletl
00480471   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00466932   2/2  illdgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllll
00475992   2/2  slaelrgigyvfqqd.....allpsltvlenlllglllagelll..lllaakeaalralllllllgletl
00500442   2/2  sl...lrrgigyvfqdpa...lfpgltvlenlllgll.......llglslaeaaeralelllllgl.edl
00367902   2/2  kgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr.ligyvpqdp...a
00436072   2/2  .....lrrgigyvfqdp...alfpgltvlenlalgllllgll.........ealaralellellglgdl.
00502742   2/2  slaelrgigyvfqqlallpslt.....vlenlalgllllglskaeaaaraaellell........gledl
00379961   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00440862   2/2  llkpd.egvilvggk.gvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddg
00509432   2/2  liflgslirsgadrasvelvfdlsdglyllerselilrrlilkpg.sgeilingkdislldlrelrr.li
00462761   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00488522   2/2  ........ggkvlyvdqee...slfp.ltvlenlalg..................gedveellerlgl..
00503741   1/2  ----------------------------------------------------------------------
00498252   2/2  sldll....rarrlgvvlqell...lfpeltveenl..................................
00475381   1/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00469452   2/2  ylsleesleqlrr.rigyvfqdpalfp...................................aeellelv
00487021   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00372302   2/2  .....................................................igyvfqllervgled.l
00484101   1/2  ----------------------------------------------------------------------
00485932   2/2  .......rrigavpqlp...vlfprltvlenlalg..............gadlaeraeellellglegfd
00493431   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00495372   2/2  llagllkp....evlvdgldltglspa.rggiglvfqteallppltvrenlealgldlrglld....rer
00424962   2/2  srevtelleelrrviglvfqdpplfprltvaenialga............eyfrdegadvllladsllrl
00436512   2/2  dgligerlrevlelirelelaelrr.rigyvfqdpalpallrllalfpaltvaenlrfglglavllllds
00496112   2/2  saeelrerr.rrigyvfqepa...lfpeltvlenlalgll..............................
00356411   1/2  ----------------------------------------------------------------------
00437982   2/2  .......rrgiglvfqliglfphltvlelvalgl..............ggilveevrellkel.......
00498531   1/2  ----------------------------------------------------------------------
00468692   2/2  kllagllkpd.sgeilvdGedlr..elre.lrrrigyvfqdp...alfpeltvlenlalgallag.....
00478441   1/2  ----------------------------------------------------------------------
00485452   2/2  ggkvlvigldifrlsarelrkrig...vfqdpa...llphltvpenldlglll.............eile
00451571   1/2  ----------------------------------------------------------------------
00448932   2/2  a....areqlgivfqdp.......................gltvlenlalgeleararellellgledyd
00468602   2/2  aae...rlgigavpqdv...plfpsltvldnlala.........rdlleaakaagydvvlidtaglld..
00404191   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00367482   2/2  dalll.......................................................rvdeiltrvg
00477011   1/1  ----------------------------------------------------------------------
00500612   2/2  llqlagllapd.sgeillggkvlyisleeslrrrrigmvfqelgldpdltv...................
00379602   2/2  ldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltledl
00532471   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00495032   2/2  lagllalglgliplggkvlyigleltlsperlrlraqsl...............................
00422142   2/2  ellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlgls
00406781   1/2  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00503372   2/2  .................................................................lvgl.
00432181   1/2  ----------------------------------------------------------------------
00475372   2/2  ................................................rrpsarellgllgellgldvl.
00508671   1/1  ----------------------------------------------------------------------
00464792   2/2  vlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevrellglllelgvlf
00392701   1/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00379962   2/2  lldpkdlrellragiplvflnfaalpasllesel....................................
00414122   2/2  dgqlledlgvlavrl.gigyvpqtlglfpaltvlellalall....lredpdlilid.............
00381442   2/2  gevdgvdltfls.....reeigyvfqepa...llpdltvlenlylg....lllalllaleegkivildgd
00489631   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00512892   2/2  .rsarrgigyvfq.................................tveellgllaelvglevrgeleel
00367291   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00371632   2/2  likllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtD...
00533151   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437942   2/2  elld..................................................................
00503742   2/2  lagllkpkfgeillfgkvvyvnvselldlkellrll..................................
00517691   1/1  ----------------------------------------------------------------------
00478412   2/2  lglkd....gigmvfqdp...alfplltvrengvalglllag......lskaeieervdlllelvgldd.
00490732   2/2  adellgvlaee....................................................lgldvl.
00469161   1/1  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457312   2/2  lsreelrklr.rrigmvfqdpalflnpgltvrenlaeplrll.klgkk..............llepvglp
00426052   2/2  gesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviellleg
00527261   1/1  ----------------------------------------------------------------------
00387202   2/2  lGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdp...alf--------------
00439862   2/2  eesreqlleraerlgldleellllgll...........................................
00478081   1/1  ----------------------------------------------------------------------
00404192   2/2  ......................................................................
00472911   1/2  ----------------------------------------------------------------------
00480472   2/2  ldgkdltlvdtpgiargrlklllearraaigivfqdv...dllltltvaenlllgldllllellkelkyd
00462762   2/2  .......lglliglvfqdp...dllpfltvlenvllpllaagliv............ivdgtlllvglre
00410531   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00405882   2/2  eldd..........................grqlvlvDtpGli.elaslgeglvrqalealeradvillv
00510562   2/2  lprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..rarrlgld.............
00498532   2/2  lprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgld.............
00457851   1/1  ----------------------------------------------------------------------
00475522   2/2  lvdleplrrdigmvfqdpa...lfplltvrenvilgllelag......lskaealarvdellelvgldde
00468952   2/2  iGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr..arrlgld..........
00487022   2/2  ra.............gevfqdyalfphltvlelldnvllgleir.gllk......aerlervevllervg
00489572   2/2  ......................................................................
00410321   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00368572   2/2  yaglarglgvvildpgdgrsvrlnplalidde..edaaellralvsemgrgeddfftpaarallralila
00515532   2/2  gvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdln...lfpsltvlenl
00477972   2/2  rpgevdgvgyvfq.....srelfpeltvagnfleg.......aevrgnlygtsrerveellea.gld.vl
00418301   1/1  ----------------------------------------------------------------------
00368502   2/2  LvGppGvGKTtlaralakll...gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgt
00489391   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00434402   2/2  aaelllreglgidfqlpdal............................drellreevlellgl.....ge
00430121   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00532532   2/2  ggfyakaigllrrkigyvfq......lfpfltvlenvalgld.....glvdeedleraenllalvgl...
00451572   2/2  ...lreaiglvtqdgelllelidegilvpdeiv...........iellrealeeldadgvildgfprllg
00493171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00484102   2/2  ldldellg.....igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilie....
00406782   2/2  .....................................................................l
00478442   2/2  lel.rgrdilmvfqppalfpllevr..............glniaevlelaglskaealkrvdlvlelvgl
00437922   2/2  rlllgsgggvdvielda..................................................sdl
00532472   2/2  lggaalldivdegrliglvfqdldllpllevlellaa.................................
00392702   2/2  .....................................................................l
00533502   2/2  p........lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdl
00379262   2/2  LvGppGvGKTtlaralAkllgapfvevdaselteggyvgedlekr....irelfqearllvfltvlenir
00480252   2/2  ....................................psapeqlgilgellgvpvvgvltgldlagalrea
00482552   2/2  gklggkvlyisteeafsperlreralsl..............................gldleelldrll
00475382   2/2  vlsrdllgllreglirigyvfqdyalfprltvlenvllgll.............................
00493432   2/2  ttreprpgevrg.igyvfqsgalfphlivagnllegaevhgllygtskerveealekgllvlldr.....
00432182   2/2  gttrdptlgvveldgrkl....................................................
00515512   2/2  gvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanv
00498812   2/2  relvaggglliglifqdfglfelldrellielllenlalglalegvilda.lrrrllelldll.......
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ......................................................................
00470732   2/2  ralakel...gagfilidgddlrekavgeleklgr.dlfqvaregglvpdilfideidallrkgpdvild
00513252   2/2  ......................................................................
00437902   2/2  ......................................................................
00420942   2/2  ...................................................................sel
00472912   2/2  pfisgddllrglageggkpl..................................................
00489632   2/2  rellgellgrgigf.......................gfqqgdlledatvlenlalllldeidka.....
00480442   2/2  ----------------------------------------------------------------------
00496572   2/2  eplgelir...glvfq...dpllldeltvlenlalgrylhlglilaalaagvgv..vldrvglsdlay..
00394722   2/2  ldlsellsv.............................................................
00410532   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RDPEAERLSGGNLQKFIVGREILRQPKLLVVNQPSWGLDAGAAAAIRQALIDLAAGGAAVLVISQDLDEL
00390411   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00422802   2/2  .lldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelak.gltvllvthdls
00379582   2/2  gldt.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvt
00381441   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00490802   2/2  ............lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEP
00510252   2/2  ..............lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllD
00532531   1/2  ----------------------------------------------------------------------
00458602   2/2  edlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdl
00420702   2/2  .lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdl
00378982   2/2  d.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthd
00457311   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00390412   2/2  lllnllrrrgiglvpqeh...dlfplltvaenialldelaglpkygnylsllkeklkelnallkelelql
00482202   2/2  ldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea
00404102   2/2  lldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvll
00475892   2/2  ldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldea
00466972   2/2  ldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldea
00530592   2/2  ldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvtHdlsea
00425572   2/2  ldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlse
00478411   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00361212   2/2  ..drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvi
00482262   2/2  ldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlsea
00480471   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00466932   2/2  ellallldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglg
00475992   2/2  ldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlsea
00500442   2/2  ldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlse
00367902   2/2  lfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraee
00436072   2/2  .drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldl
00502742   2/2  ldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldea
00379961   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00440862   2/2  lteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdp...nlfpgl
00509432   2/2  gyvpqdpn...llfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeele
00462761   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00488522   2/2  dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrla
00503741   1/2  ----------------------------------------------------------------------
00498252   2/2  .....drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvll
00475381   1/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00469452   2/2  gle.dlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgv
00487021   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00372302   2/2  ldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlel
00484101   1/2  ----------------------------------------------------------------------
00485932   2/2  vvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltv
00493431   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00495372   2/2  viellelvgleelldrlpre...........lsggnqrqrvvia.alallpkllllDEptsaldvslrae
00424962   2/2  agalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalD
00436512   2/2  atrlaqakreisalarellervglpgdlftllsrlderagnlSgGqrqrvaiaralasdpdllilDEpts
00496112   2/2  ..drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvi
00356411   1/2  ----------------------------------------------------------------------
00437982   2/2  ..........lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdl
00498531   1/2  ----------------------------------------------------------------------
00468692   2/2  ..................lgl.aeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre..
00478441   1/2  ----------------------------------------------------------------------
00485452   2/2  rvlellelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdl
00451571   1/2  ----------------------------------------------------------------------
00448932   2/2  vvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltv
00468602   2/2  ldrlvgelsggqkqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKlDgta
00404191   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00367482   2/2  lsdlldrgls..lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvv
00477011   1/1  ----------------------------------------------------------------------
00500612   2/2  ..........arerviellelvgl.lelldrlprelkrsggqrqrvviDaralllrpel..lDEptsald
00379602   2/2  lelenlsfsygg..kealkdlslaiepgelvlivGptGsGKTTllkallgllppd.egiitiegpdel..
00532471   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00495032   2/2  .....gldldellerllvidllelvglle.lldrlprelsggqrqrvviDalalllrpell..Deptsal
00422142   2/2  y..gdpealkdlslaippgglvlltGptGsGKtTllralagllnpd.egriltiedp.............
00406781   1/2  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00503372   2/2  pgkalrplstlSGGekqrlalalalalaellppplllLDEptagLDpenrerllellrelaseggqvivv
00432181   1/2  ----------------------------------------------------------------------
00475372   2/2  vgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathd
00508671   1/1  ----------------------------------------------------------------------
00464792   2/2  ........................................aaellervglvaatadeppgelsggqrqrl
00392701   1/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00379962   2/2  .........lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtiera
00414122   2/2  ................sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgl
00381442   2/2  reraeellellgldadlviilpasleellerldrrggelsggqkqRvalaral-----------------
00489631   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00512892   2/2  lktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel
00367291   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00371632   2/2  ifylpaeqlkrigllfq..kg..lpealdveell............................ellldlke
00533151   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437942   2/2  ......pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrle
00503742   2/2  .........................lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlld
00517691   1/1  ----------------------------------------------------------------------
00478412   2/2  lldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.............
00490732   2/2  lgarggdlsgglrqr..larallgdydvliiDtpgt.ldvllelallellkellaelgadvvllvvdatl
00469161   1/1  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457312   2/2  .evldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirl
00426052   2/2  ldtlagggg..........vvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadt
00527261   1/1  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00439862   2/2  ....siliadplglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtv
00478081   1/1  ----------------------------------------------------------------------
00404192   2/2  .delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrp
00472911   1/2  ----------------------------------------------------------------------
00480472   2/2  pvilllnkidllddrllrraeaeerieellelvgls.al-------------------------------
00462762   2/2  alrkll.gllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadivii
00410531   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00405882   2/2  vdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee.......lggtv
00510562   2/2  ....ldrlllldaltv...........................eellalaerllsggkvdlvviDsltal
00498532   2/2  ............ldellllpaltveellala...................erllsggkpdlvviDsltal
00457851   1/1  ----------------------------------------------------------------------
00475522   2/2  llldrlp.....sggqqqeilrvaiallilpvllgralallpelllldeptsaldp--------------
00468952   2/2  ...............lddllllpaltveellala...................erllsggkpqlvviDsl
00487022   2/2  llldrippa...lsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpd
00489572   2/2  ...........lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldea
00410321   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00368572   2/2  laeepe...ptldellellselg.lrdladrleklvagglagllegaektaasilellrkllallldlgg
00515532   2/2  ....anvpillvlnKiDlleakeraeellellgl.gdlldklpselsgGqkqrvalaral----------
00477972   2/2  ldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdlee
00418301   1/1  ----------------------------------------------------------------------
00368502   2/2  vlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasvial
00489391   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00434402   2/2  vvivdvydlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlev
00430121   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00532532   2/2  eeipnrypse..lsgGqqqrv...........illldEPtsgLdpvsr......................
00451572   2/2  qaell..lsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild-----
00493171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00484102   2/2  Gllelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasil---------------
00406782   2/2  lgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrlls
00478442   2/2  d.drypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkl.lgidallelvdrl--
00437922   2/2  rgvddlreligevlqalglllgg........................kpdvlllDEi.drldpdaqnall
00532472   2/2  ...rleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlp
00392702   2/2  lgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrlls
00533502   2/2  aydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehyle
00379262   2/2  ldaseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllg.
00480252   2/2  lellllegydvvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgv
00482552   2/2  vidatdlldllellerlrrl.....lsegkvdlvviDslallarael..ldepllgldarelrellrlLk
00475382   2/2  ...llgglvvildggvrqrlalarallldpdvllldeplllldaalr...........dlpdlvifldad
00493432   2/2  .........dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieyd
00432182   2/2  ......vliDtpGleefasggekqrvalalallreadvlllvvdadeptsfldle....llellrellla
00515512   2/2  pillvlnKiDlleaklvllllvglfdll...........dglpselsggqkqrvala-------------
00498812   2/2  ...gldvvile.gplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaa
00356412   2/2  -----eelsggqkqrvalaralakdpdilll..ptsaldgegvdelfdallelilelnlrivtth-----
00386742   2/2  .....selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldgll
00470732   2/2  gagrtpeqlealldllee........lgrpvvviilttnrevlldral.rRpgrllldep..eldppdre
00513252   2/2  ..........gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevli
00437902   2/2  ..vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvl
00420942   2/2  lgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqals
00472912   2/2  .....gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvifld
00489632   2/2  ..ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarlee
00480442   2/2  -------lsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvi
00496572   2/2  ............gfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgd
00394722   2/2  ..........sdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledg-
00410532   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LEIADSIAVMYHGRLSPPLAAAETGREQLGLLMGGSGWPQQSVHDAIPA---------------------
00390411   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00422802   2/2  la.aladrilvlddGrivelgtp-----------------------------------------------
00379582   2/2  hdldealrladrilv-------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00490802   2/2  tsgLDpetraellel-------------------------------------------------------
00510252   2/2  EPtsgLDpetraell-------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00458602   2/2  dealrladrilvldd-------------------------------------------------------
00420702   2/2  sealrladrilvldd-------------------------------------------------------
00378982   2/2  lsealrladrilvld-------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00390412   2/2  kelarllelleglke-------------------------------------------------------
00482202   2/2  .rladrilvlddGri-------------------------------------------------------
00404102   2/2  vthdldealrladrilvlddGrivelgtpeellenp----------------------------------
00475892   2/2  lrladrilvlddGri-------------------------------------------------------
00466972   2/2  lrladrilvlddGri-------------------------------------------------------
00530592   2/2  l.ladrilvlddGri-------------------------------------------------------
00425572   2/2  alaladrilvlddGr-------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00361212   2/2  lvthdldlldsallr-------------------------------------------------------
00482262   2/2  l.ladrilvlddGri-------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00466932   2/2  dlldrpvstLSGGer-------------------------------------------------------
00475992   2/2  lrladrilvlddGri-------------------------------------------------------
00500442   2/2  alrladrilvlddGr-------------------------------------------------------
00367902   2/2  llellglgg.lldrpvstLSgGe-----------------------------------------------
00436072   2/2  alaladrivvl-----------------------------------------------------------
00502742   2/2  lrladrilvlddGri-------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00440862   2/2  vvlisaltgegldel-------------------------------------------------------
00509432   2/2  ligplldglellvglngl.ldrplselSgGekqrlala--------------------------------
00462761   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00488522   2/2  kelgvtvllvthdld-------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00498252   2/2  vthdldeaealadrv-------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00469452   2/2  tvilvtH........-------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00372302   2/2  aalladrvvvlndgr-------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00485932   2/2  lvvthddgtakggaalslaleladri--------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00495372   2/2  ilrlLkrlakelgvt-------------------------------------------------------
00424962   2/2  geivlslllalkrly-------------------------------------------------------
00436512   2/2  glDpe-----------------------------------------------------------------
00496112   2/2  lvthdleeaedlads-------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437982   2/2  sellpallsrcqvir-------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00468692   2/2  ilellrellkelgyt-------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00485452   2/2  dkelgrtiilvthd--------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00448932   2/2  lvvthlDllakggad-------------------------------------------------------
00468602   2/2  kgghdlslalrladr-------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00367482   2/2  tHdlelaalaadriv-------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00500612   2/2  vslraeilrlLkrla-------------------------------------------------------
00379602   2/2  .....lrnkigyvfQ-------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00495032   2/2  dvqlvaeilrlLkrl-------------------------------------------------------
00422142   2/2  ieyvfqspnlfpl---------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00503372   2/2  tHdpelaarladrilvlk----------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00475372   2/2  ldavlkaadrilvld-------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00464792   2/2  aiAraladdqgkpvl-------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00379962   2/2  gitlllpagvtviaa-------------------------------------------------------
00414122   2/2  tvlivlnKiDllse--------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00512892   2/2  .eladriallrrgri-------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00371632   2/2  gledilvpvlsggqk-------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437942   2/2  eldpallsRfdvief-------------------------------------------------------
00503742   2/2  petlspdvlelLlr--------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00478412   2/2  ....ldiilalellllde----------------------------------------------------
00490732   2/2  gleaadrilvlleglg------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457312   2/2  itrdlgeagrsadrv-------------------------------------------------------
00426052   2/2  eeellellerlarey-------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00439862   2/2  ilvsqltelildal--------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00404192   2/2  eeldqallrlls----------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00462762   2/2  thdls.ieevadril-------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00405882   2/2  vlvSahdgegldellda-----------------------------------------------------
00510562   2/2  apalelsllldept--------------------------------------------------------
00498532   2/2  apslllldepgrv---------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00468952   2/2  talrpalllldeptg-------------------------------------------------------
00487022   2/2  lv--------------------------------------------------------------------
00489572   2/2  er.aDrvavlddGtpeell---------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00368572   2/2  pa--------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00477972   2/2  alelldrilvll----------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00368502   2/2  lgggrelrdgellka-------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00434402   2/2  alerrlkrlg------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00532532   2/2  .....leladriyvl-------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00406782   2/2  gvtviattndlee---------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00437922   2/2  kl--------------------------------------------------------------------
00532472   2/2  lp--------------------------------------------------------------------
00392702   2/2  gvtviattnrpeeld-------------------------------------------------------
00533502   2/2  llekad.rvvvidagg.sleevv-----------------------------------------------
00379262   2/2  ..glglpevgelllell-----------------------------------------------------
00480252   2/2  vltkldlvaalgaal-------------------------------------------------------
00482552   2/2  rlakelgvtvilts--------------------------------------------------------
00475382   2/2  pe--------------------------------------------------------------------
00493432   2/2  yvivnddleealee--------------------------------------------------------
00432182   2/2  gkpvilvlnKiDl---------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00498812   2/2  dividnd.lslee---------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  lp--------------------------------------------------------------------
00470732   2/2  erlei-----------------------------------------------------------------
00513252   2/2  erlldrvllldegsl-------------------------------------------------------
00437902   2/2  ii--------------------------------------------------------------------
00420942   2/2  nvtviattnrpeel--------------------------------------------------------
00472912   2/2  ad--------------------------------------------------------------------
00489632   2/2  ryradlvivtddl...------------------------------------------------------
00480442   2/2  vnddleealelllai-------------------------------------------------------
00496572   2/2  teevlehrleraeel-------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------