[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38484.1


[Show Plain Result]

## Summary of Sequence Search
   1::489
  27::241    1e-75 52.8% 0046672 00466721 1/1   inding domain                           
  16::241  3.7e-65 48.2% 0046342 00463421 1/1   inding domain                           
  25::241  1.8e-63 46.0% 0046490 00464901 1/1   inding domain                           
 244::489    2e-61 35.0% 0046489 00464891 1/1   inked oxidases, C-terminal domain       
 215::489  4.5e-58 31.5% 0046341 00463411 1/1   inked oxidases, C-terminal domain       
  36::240  7.2e-54 42.9% 0044931 00449311 1/1   inding domain                           
  33::240  4.1e-52 47.3% 0047282 00472821 1/1   inding domain                           
 214::489  1.3e-49 34.7% 0046671 00466711 1/1   inked oxidases, C-terminal domain       
  27::239  4.5e-49 46.6% 0047231 00472311 1/1   inding domain                           
  51::252  2.2e-45 47.6% 0050017 00500171 1/1   inding domain                           
 214::491  2.5e-21 23.5% 0050336 00503361 1/1   inked oxidases, C-terminal domain       
   1::489


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGGRGQNQARRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNLYRGHSPLVLR
00466721   1/1  --------------------------lealldeLrailgadnvltdpalllayatdas.lyrglPlaVvl
00463421   1/1  ---------------llllllllaalledllealrailggevvltdeadllaystdllwsslygglplav
00464901   1/1  ------------------------lllplalllllslalledlleelrailggdnvltllssdpadllay
00464891   1/1  ----------------------------------------------------------------------
00463411   1/1  ----------------------------------------------------------------------
00449311   1/1  -----------------------------------kilggdvvltdpadlaaystdwsglygglpaavvl
00472821   1/1  --------------------------------lllrlllpglvllddlllalytnwa.glvgglplavvl
00466711   1/1  ----------------------------------------------------------------------
00472311   1/1  --------------------------mealleellkllgegnvltdesllllttfd....igglpdavvl
00500171   1/1  --------------------------------------------------yslaklttfr.igglpdavv
00503361   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQ
00466721   1/1  Prsteevaavlkacvelglpvvprgggtgltggavplgsdydrgvvvlslerlnrileid.egltvvvep
00463421   1/1  vlPtsteevaaivklanehgvpvvprgggtsllggalplgvdggvvldlsrmnrilevdpedltvtVeaG
00464901   1/1  stdastylpllllllllglPlavvrPesveevaaivklarehgipvvprggGtsllvggsvplgrggvvi
00464891   1/1  ----------------------------------------------------------------------
00463411   1/1  ----------------------------------------------------------------------
00449311   1/1  Prsveevaaavklarehalsglpvvvrggghsllggalp.aggvvldlsrlnriellellevdpeggtvt
00472821   1/1  PrsteevaalvklaaehglpvvprGggtslsggavpdgslvlgglvlslsrlngilevdlsaedltvtve
00466711   1/1  ----------------------------------------------------------------------
00472311   1/1  PesteevaailklanehglpvvvrGggtnllggdvgfdg.vvidlsrlnki.eided..tvtvgaGvlla
00500171   1/1  lpesveevaallklanehglpvlplGggsnllggd..lfdgvvi.lsrlngileidepedltvtveAGvl
00503361   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HAQERAASVDRLFPLSLGAQGSCTIGGNLSTNAGGTAALAYGLARDMALGLEVVLADGRILNLLSKLKKD
00466721   1/1  GvtladlnealaplgllfppdpgsagisatigGnvatnagGllvlrygatrdlvllalvdedgelelvnh
00463421   1/1  vtlgdlyealaehgltlpvdpg..gsatigGvialtnagGlgslryGltrdnvlglevvladGevvrlga
00464901   1/1  dlsrllnkileidpeggtvtveaGvtlgdlyealaehglelalpldpgscitvtvGGaiagn..Gigslr
00464891   1/1  ----------------------------------------------------------------------
00463411   1/1  ----------------------------------------------------------------------
00449311   1/1  veaGvtlgdlyealaehglalpvdg.slptvtvGGliaggghgtlslryGltadnvlglevvladGevvt
00472821   1/1  AGvvladlaealakhglalp.nlpsigsatiGGaiatnaggtglllgGglgllslrygllsdlvlglevv
00466711   1/1  ----------------------------------------------------------------------
00472311   1/1  dlvealaehgl.lgleplsgipgtiGGaiatnagg.....yGletrdnvlslevvladGeivtls....k
00500171   1/1  ladlvealaehgl.fgleplsgipgtiGGaiatnagg.....yGveirdlvlslevvdladgeiltlsae
00503361   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAE
00466721   1/1  lglevvladgevldtlsglrkdllaldleel---------------------------------------
00463421   1/1  ellknsagydlfwalrgglldglfsegtlGi---------------------------------------
00464901   1/1  yGlaadnvlglevvladGeivtasgrllknl---------------------------------------
00464891   1/1  ---------------------------------aGkatalvgfprlgdledaleavrplrlngvipnvvl
00463411   1/1  ----patrllllffgsegtlgeavllliplgip..llipglvvllnvlleaallvlrrgelpaalelmdd
00449311   1/1  .....asasegydlfwalrgsegtlGvvte----------------------------------------
00472821   1/1  ladGevltls....kdelgydlfqallgse----------------------------------------
00466711   1/1  ---ydlkvlyiGtedpgtLgiitraiLklfpnlPisgeylhrdafdiaekygkdtfllilklgtdalpll
00472311   1/1  ddlgfdlrglflgseg..giiteatlkll-----------------------------------------
00500171   1/1  ..klnfgyrls.lfkgsegtlgiiteatlkllplpkavilal----------------------------
00503361   1/1  ---pdlvrllrgsYgdlgiftedqlrLiplpegaallllgrfdyvegavelvddvllnlarsipagledm


                         -         *         -         -         -         -         +:350
query           IALDFSVRHGHNRDPLQSRHPWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKL
00466721   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00464901   1/1  ----------------------------------------------------------------------
00464891   1/1  lreilqsllllgkrgllpaalEllmdavaleavnal.glglpl.......llveleG.seesvdallerl
00463411   1/1  valeavlallg.......lglplllveleG.seaaveaqlerleelleelggldavvaqdeeerellwal
00449311   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00466711   1/1  falkglldallsalefldknlldrvlqllskllpdhlPkrllefrddyehhlllelsg...dgieeaeal
00472311   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00503361   1/1  drvailavepfagvlycle......lvkeydgsdeevaevleeveellrdlgfvrgvvftddveyvdfln


                         -         -         -         -         *         -         -:420
query           REEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA
00466721   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00464901   1/1  ----------------------------------------------------------------------
00464891   1/1  eeileelggldvvvaddeae.ealwalrkdlppalgalgplgllgiiagavvivldvavppsgkrlaell
00463411   1/1  Reaalglvtllelgavgrrpggavlwedvavpllgsrlaeflreirallaky..glrgvifghagdgnlh
00449311   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00466711   1/1  leklfedll..gavfacseeeaeklwlhRfaaagaavryravhkdevgdilalDiAlPrndldwfeelpe
00472311   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00503361   1/1  rvaglelalrakglwdvphpwldlfvPrsrlaeflalvlell...lygldvvgvilvyPllgskwdgnlh


                         -         -         +         -         -         -         -:490
query           AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKVL-
00466721   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00464901   1/1  ----------------------------------------------------------------------
00464891   1/1  eeirelldky..glrvvifghagdGnlhlnilllfdlddpeeleraealldalrelvlelgGsisgehg-
00463411   1/1  lnilllfdlddpeeleraealndeiaelvlklG...sgeHgiGllkaeylaaelgpallalmraiKaaf-
00449311   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00466711   1/1  eilekl...llklyyGHlgdgnlHldilvkkgvdvl.......alkelllelldelgGelpAEHGvGhl-
00472311   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00503361   1/1  lllPdedvfylvallrsalppgelerlealnreilelcvdaGgsiygehgvgldkadwv.rhfgpalwel