[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38488.1


[Show Plain Result]

## Summary of Sequence Search
   1::339
 125::305  1.2e-47 46.2% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
 128::321  2.5e-46 42.1% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
 125::309  3.5e-46 45.6% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
 125::314    4e-46 42.7% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
 125::311  4.3e-46 45.0% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
   1::160  3.3e-44 44.2% 0050889 00508891 1/1   -like                                   
 124::300  8.1e-44 42.8% 0050040 00500401 1/1   )-binding Rossmann-fold domains         
 124::307    1e-43 45.0% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
   1::162  1.1e-43 45.7% 0051263 00512631 1/1   -like                                   
 125::305  1.7e-43 42.9% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
 125::306  2.5e-43 45.6% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
   1::171  1.4e-42 40.7% 0047654 00476541 1/1   -like                                   
   1::156  1.6e-42 46.3% 0041738 00417381 1/1   -like                                   
 125::310    2e-42 43.4% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
   1::161  2.2e-42 43.1% 0048862 00488621 1/1   -like                                   
 125::307  4.3e-42 44.8% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
 125::305  5.1e-42 44.0% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
 125::336  6.2e-42 40.8% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
 126::305  2.2e-41 45.5% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
 125::305  1.5e-40 43.5% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
   1::162  3.5e-40 41.2% 0047994 00479941 1/1   -like                                   
   1::157  4.2e-40 37.9% 0040817 00408171 1/1   -like                                   
   1::339  1.6e-38 40.9% 0046113 00461131 1/1   -like                                   
   1::172  2.5e-38 42.3% 0049685 00496851 1/1   -like                                   
   1::160  3.1e-38 39.7% 0047480 00474801 1/1   -like                                   
 125::305  3.9e-38 42.4% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
   1::160  4.6e-38 38.1% 0043275 00432751 1/1   -like                                   
   1::157  5.8e-38 36.4% 0039779 00397791 1/1   -like                                   
 125::305  1.8e-37 42.5% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
   1::167  2.5e-37 38.4% 0042365 00423651 1/1   -like                                   
   1::170  8.7e-37 39.6% 0048672 00486721 1/1   -like                                   
   1::159  1.9e-36 40.7% 0042905 00429051 1/1   -like                                   
   1::160  7.7e-36 39.1% 0050001 00500011 1/1   -like                                   
   1::188  2.1e-34 43.3% 0046724 00467241 1/1   -like                                   
   1::149  2.4e-34 41.3% 0050202 00502021 1/1   -like                                   
 125::307  3.9e-32 40.1% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
 136::293    2e-31 42.5% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
 148::288  1.2e-30 44.2% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   1::172    5e-30 33.8% 0038267 00382671 1/1   -like                                   
   1::175  4.2e-27 37.3% 0045092 00450921 1/1   -like                                   
   1::165  4.3e-27 37.7% 0046449 00464491 1/1   -like                                   
 136::286    5e-27 39.6% 0039780 00397801 1/1   )-binding Rossmann-fold domains         
   2::159  5.6e-27 36.6% 0047104 00471041 1/1   -like                                   
 122::305  1.3e-26 33.7% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
 125::330  3.1e-26 33.1% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
 134::306  1.2e-23 31.9% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
   1::184  5.9e-22 28.9% 0047232 00472321 1/1   -like                                   
   1::184  1.8e-21 34.1% 0047181 00471811 1/1   -like                                   
   1::159  4.3e-21 31.8% 0046314 00463141 1/1   -like                                   
 125::307  4.3e-21 32.5% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
 132::291  9.6e-20 32.4% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
 122::306  1.2e-19 30.5% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
 130::299  3.4e-18 31.8% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
 125::305  1.4e-17 29.7% 0047059 00470591 1/1   )-binding Rossmann-fold domains         
   1::159  1.8e-17 31.2% 0046252 00462521 1/1   -like                                   
   1::137  8.4e-16 36.2% 0047235 00472351 1/1   -like                                   
   1::175  3.9e-14 34.1% 0047846 00478461 1/1   -like                                   
 122::266  4.9e-14 27.7% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
 122::263  7.7e-13 28.6% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
 137::322  2.6e-12 25.6% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
 137::265  2.4e-11 29.7% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
 154::252  6.7e-11 33.0% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
 131::270  8.7e-10 26.4% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
 152::269  1.8e-09 31.4% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
 147::269  3.2e-08 30.1% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
  20::128  1.1e-07 35.7% 0044605 00446051 1/2   -like                                   
   1::156  5.4e-07 28.5% 0036743 00367431 1/1   -like                                   
 154::285  3.1e-06 30.4% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
 153::250  4.9e-06 34.6% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 134::241  5.7e-06 27.4% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
 149::241  6.6e-06 31.3% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
 136::313  7.5e-06 23.4% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
 130::301  8.1e-06 23.7% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
 130::223  1.1e-05 26.4% 0034872 00348721 1/1   )-binding Rossmann-fold domains         
 143::241  1.5e-05 31.7% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
 133::300  1.8e-05 24.0% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
 142::279  2.3e-05 26.7% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
 152::269  2.3e-05 31.7% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
 136::242  2.9e-05 33.7% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
 143::241  3.5e-05 23.7% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
 134::241  3.8e-05 24.7% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
 152::241  4.1e-05 39.1% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
 140::241  5.3e-05 32.9% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
 142::241  6.6e-05 34.9% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
 153::241  6.9e-05 31.4% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
 144::241    7e-05 23.5% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
 143::241  7.2e-05 30.1% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
 154::259  7.8e-05 29.7% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
 150::241  9.5e-05 29.3% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
 152::241   0.0001 23.6% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
 152::241   0.0001 24.4% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
 153::252  0.00011 35.4% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
 154::241  0.00011 36.8% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
 153::241  0.00012 26.7% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
 138::241  0.00013 23.5% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
 144::241  0.00014 34.1% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
 113::282  0.00018 21.6% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
 148::241  0.00018 25.8% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
 150::195  0.00028 32.6% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
 152::241  0.00029 24.4% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
 148::241   0.0003 28.1% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
 149::241  0.00031 24.7% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
 152::241  0.00031 29.3% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
 143::241  0.00034 24.5% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
 149::241  0.00036 29.5% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
 146::195  0.00038 30.0% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
 150::241  0.00039 28.7% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
 147::248  0.00045 26.4% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
 153::241  0.00047 34.3% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
 144::195  0.00051 28.8% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
 152::241  0.00052 24.4% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
 153::195  0.00053 37.5% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
 147::241  0.00056 26.8% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
 154::241  0.00056 25.0% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
 153::195  0.00059 37.2% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
 144::241   0.0006 25.8% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
 148::241  0.00064 27.0% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
 147::241  0.00071 26.7% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
 120::298  0.00074 19.9% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
 151::241  0.00074 25.3% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
 149::241  0.00082 27.3% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
 153::223  0.00082 30.4% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
 153::195  0.00084 34.9% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
 148::241  0.00086 26.1% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
 153::241  0.00087 30.3% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
 152::241  0.00089 34.2% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
 152::195   0.0009 36.6% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
 149::241  0.00091 27.3% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
 153::241  0.00095 22.5% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
 145::195  0.00097 31.4% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
 152::241  0.00099 27.9% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
 152::241    0.001 29.8% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
 292::339       21 39.6% 0044605 00446052 2/2   -like                                   
   1::339


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDVAGEI
00502041   1/1  ----------------------------------------------------------------------
00487991   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00502031   1/1  ----------------------------------------------------------------------
00508891   1/1  petmkalvltgpggpevlele.evplpepgpgevlvkvlaaglnpsDllillglyplvlplplvlgheaa
00500401   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00512631   1/1  etmkalvltgpggpevlelelevplpepgpgevlvkvlaaglnpsDllilsglyplvpplplvlghegaG
00513271   1/1  ----------------------------------------------------------------------
00476551   1/1  ----------------------------------------------------------------------
00476541   1/1  Mkalvltgpgdlele....evplpepgpgevlvkvlaagingsDlhlirlglyplll..plvlGhEaaGv
00417381   1/1  mkalvldelggpevlelv.elplpelgpgevlvkvhaaglnykDllartglypvvpglplvpGlefaGvv
00508901   1/1  ----------------------------------------------------------------------
00488621   1/1  ltlsllmkamkalvlggpgplele.evpvpepgpgevlvkvlaagingsDlhirrglypvp.klplvlGh
00488631   1/1  ----------------------------------------------------------------------
00481071   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00486731   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00479941   1/1  smpltmkalvltgpgdp..lel.eevplpepgpgevlvkvlaagingsDlhillglyplplklplvlGhE
00408171   1/1  lslvitmkAavltgpggp...leleevpvpepgpgeVlvkvlaagicgtDlhilrglypl.vklplvlGh
00461131   1/1  lllslpltmkaavltgpggp..lele.evpvpepgpgevlvkvlaagicgsDllhirrglyp..lplPlv
00496851   1/1  sktmkalvltgpgdpevlele.evplpepgpgevlvkvlaaglnpsDllilrglyplvvplplvlGhega
00474801   1/1  mkalvltgpgdp...leleevplpepgpgevlvkvlaaglngsDllillglyplllelplvlGhEaaGvV
00405511   1/1  ----------------------------------------------------------------------
00432751   1/1  mkAlvltgpgdp...leleevpvpepgpgevlvkvlaagicgtDlhiyrgglpllvklplvlGhEaaGvV
00397791   1/1  mkAavltgpgdp...leleevpvpepgpgeVlvkvlaagicgsDlhilrglyplllllllllvklplvlG
00461141   1/1  ----------------------------------------------------------------------
00423651   1/1  aaalpltmkalvltgpg....pleleevpvpepgpgevlvkvlatgicgtDlhilkgglplalvlklplv
00486721   1/1  mtlslpltmkalvltgpgdp..lele.evpvpepgpgeVlvkvlaagicgsDlhilrglypvp..lplvl
00429051   1/1  mkAlvlygagdpevlrle.evplpepgpgevlvkvkavgingtDlkilsggyp.vlklplilGhEaaGvV
00500011   1/1  mkaavvlggpgplel...eevplpepgpgevlvkvlaagicgsDlhilrglyp.llklplvlGhEaaGvV
00467241   1/1  mstmkalvltgpgdplele....evpvpepgpgeVlvkvlaagingsDlhilrglypv..plplvlGhEg
00502021   1/1  lpltmkalvltgpgdplele....evpvpepgpgeVlvkvlaagingsDlhirrglypvlp.lplvlGhE
00432761   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00382671   1/1  lilmkAvvvlatgdPkevlflkveeiplpalgpgevlvkviaagicgtDlailqgvyptkpvktignptg
00450921   1/1  mkallllglgklelle....vpePepgPgevlvrtlavgvcgtDlhvldgdlpg.velgiilGheivGeV
00464491   1/1  kmkAlvllgpgdlrle....evpvpepgpgevlvkvaatgiCgsDlhlykhgdlgdllvklPlvlGHEia
00397801   1/1  ----------------------------------------------------------------------
00471041   1/1  -kAavllgpgdplrl...edvpvpelpgpgevlvkvaaagiCgtDlhilegllpglllvklPlvlGhEia
00383791   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00472321   1/1  stagkvikmkAavlrgagkplei...eevelpepgpgeVlvkvvatGiCgtDlhvldgllp..vplPlvl
00471811   1/1  stlgkvikmkAavlrgpgkpleie....evelpepgpgeVlvkvvatGiChsDlhvldgllp..vplPvv
00463141   1/1  stagkvikmkAavlreagkplei...eevelpepgpgevlvkvvatGiChtDlhvldgalp..vplPlvl
00423661   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00470591   1/1  ----------------------------------------------------------------------
00462521   1/1  stagkvikmkAavlrepg..kpleiee.velpepgpgeVlvkvvatGvChtDlhvldgalpvp..lPvvl
00472351   1/1  stagkvikmkAavllgpgkpleie...evelpepgpgeVlvkvvatGiChsDlhvldgelp..vplPlvl
00478461   1/1  tmkavvylgpgkvev....eevplPelegpggkklegdvivkvtatgiCgsDlhilrgllp..velplvl
00374371   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00446051   1/2  -------------------evplpepgdgevlvkvlylsv...DPymrgrmypvelgevmvgg..gvgev
00367431   1/1  atagkvikckAavlweag...kplvieevevapPkagevlvkivatglChtdlhvlsgalp..llfPvil
00387841   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00376621   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00468011   1/1  ----------------------------------------------------------------------
00509551   1/1  ----------------------------------------------------------------------
00517631   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00416921   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00509671   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00450761   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00413661   1/1  ----------------------------------------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00513551   1/1  ----------------------------------------------------------------------
00510931   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00451531   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00520851   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00510061   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00515111   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00498451   1/1  ----------------------------------------------------------------------
00369221   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00514401   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00506551   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00483611   1/1  ----------------------------------------------------------------------
00471241   1/1  ----------------------------------------------------------------------
00512031   1/1  ----------------------------------------------------------------------
00512791   1/1  ----------------------------------------------------------------------
00446052   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VKVGEGVEGWKAGDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTA
00502041   1/1  ------------------------------------------------------lsleeaaalplaglTA
00487991   1/1  ---------------------------------------------------------eeAAalplaglta
00512641   1/1  ------------------------------------------------------lsleeaAalplagltA
00474811   1/1  ------------------------------------------------------lsleeaAalplagltA
00502031   1/1  ------------------------------------------------------lsleeaAalpeaglta
00508891   1/1  GvVvevgsg..gfkvGdrVvvlllv......lgllldGgfaeyvvvpadllvklPdg.sleeaaavlpla
00500401   1/1  -----------------------------------------------------glsleeaAalglaglTA
00462531   1/1  -----------------------------------------------------glsleeaalllcallta
00512631   1/1  vVvevGsgvtgfkvGdrVvvllll...........dggfaeyvvvpadllvklpdgllsleeaaalpl..
00513271   1/1  ------------------------------------------------------lsleeaAalpeallta
00476551   1/1  ------------------------------------------------------lsleeaaalpepllta
00476541   1/1  VvevGsgvtgfkvGdrVvvlpvlscgeceaclsglenlcenllfglllgllldGgfaeyvvvplaadllv
00417381   1/1  vavgeg..gfkvGdrVvalgl......glgetldGglaeyvvvpadllvplPdglsleeAaalptaglTA
00508901   1/1  ------------------------------------------------------lsleeaAalplaglTA
00488621   1/1  EaaGvVvevGsgvdtgfkvGdrVvvlplvpscgeceaclsglenlcenllllllgllllgltldGgfaey
00488631   1/1  ------------------------------------------------------lsleeaAallcaglta
00481071   1/1  ------------------------------------------------------lpleeaaallcpllta
00485161   1/1  ------------------------------------------------------lsleeaAalplaglta
00486731   1/1  -------------------------------------------------------pleeaaallcallta
00467251   1/1  ------------------------------------------------------lsleeaaalleallta
00479941   1/1  gaGvVvevGsgvtgfkvGdrVvvlplvgscgeceaclsglenlcenllllgllldGgfaeyvvvpadllv
00408171   1/1  EaaGvVvevGsgvtgfkvGdrVvvlpliscgeCraclsgrpnlcenlrllnlkgllldgtlrlslgglll
00461131   1/1  lGhEgaGvVvevGsgvtgfkvGdrVvvlpviscgeceaclsglenlcenllvlglagllldgtlrlllgg
00496851   1/1  GvVvevgsg..gfkvGdrVvvlplv......lgllrdGgfaeyvvvpadllvklPdglsleeaa......
00474801   1/1  v...........GdrVvvll............ldggfaeyvvvpadllvklPdglsleeaaalplalglt
00405511   1/1  ------------------------------------------------------lsleeaaallcaglta
00432751   1/1  vevGsgvtglkvGdrVvvlplliscgecryclsglpnlcenllflgvlldGgfaeyvvvpaanlvklpdg
00397791   1/1  hEaaGvVvevGsgvtgfkvGdrVvvlpllscgecraclsglenlcenllflgllldggfaeyvvvpaall
00461141   1/1  ------------------------------------------------------lpleeaaallcalata
00423651   1/1  lGhEavGvVvevGsgvtglkvGdrVvvlpllscgecpyclagrynlcegllflgv..lgldGgfaeyvvv
00486721   1/1  GhEgaGvVvevGsgvtgfkvGDrVvvlflvscgeceaclsglenlcenlvlglggglllggttrlllggk
00429051   1/1  eevGsgvtglkvGDrVvvll...........cgdgglaeyvvvdedllvklPeslsllevleaaallval
00500011   1/1  vavGsgvtglkvGdrVvvlplviscgeceacrsglenlcenllllglagllllgllldGgfaeyvvvpar
00467241   1/1  aGvVvevGsgvtgfkvGDrVvglf.iscgeceaclaglenlcenllllglggdlldgtlllsllglslll
00502021   1/1  gaGvVvevlGsgvtgdlslfkvGdrVvglpviscgeceacllsglenlcpnllllglngglllgllldGg
00432761   1/1  ------------------------------------------------------lplelaaalglallta
00387111   1/1  -----------------------------------------------------------------pgltA
00429061   1/1  ----------------------------------------------------------------------
00382671   1/1  elpvvlGhEavgvViavGsnVsslkpGDrVvpivvs...........dgalaeyavvdenaliklpdel.
00450921   1/1  vevGsnveglkvGdrVvvpallscgtclycrrgllnlcddlllgellglgrdGafaeyvlvpaadaflvk
00464491   1/1  GvVvevGsgvtglkvGdrVvveplvscgeceycrrgrynlcenllflglppldGgfaeyvvvpaallvkl
00397801   1/1  -----------------------------------------------------------------Caltv
00471041   1/1  GvveevGegvtglkvGdrvvvllllscgtCraCraglenlCenllllGllldGgfaeyvvvparllvklp
00383791   1/1  ---------------------------------------------------pkdvdlrvllllpeiglta
00385671   1/1  ------------------------------------------------------lplellallGcgllta
00367461   1/1  ---------------------------------------------------------------lellsva
00472321   1/1  GHEgaGiVeevGegVtdlkpGDrVvllfiisCgeCryCrsglenlCenlgvllllgvlldgtlafyv..d
00471811   1/1  lGHEgaGvVeevGegVtgvkvGDrVvllflpscgeCryClsglenlCenlgalnlggvlpggtaeltv.d
00463141   1/1  GHEgaGiVeevGegVtdlkvGdrVvllfllsCgeCryCrsglenlCenlgvlvllgvlldgtlrfylvgg
00423661   1/1  ------------------------------------------------------lple.lgalvltlata
00367441   1/1  -------------------------------------------------------------llglafgtg
00445261   1/1  ---------------------------------------------------pkslpllelallltgllta
00496861   1/1  -----------------------------------------------------------Aasilllglts
00470591   1/1  ------------------------------------------------------ldllqaatllvnPltA
00462521   1/1  GhEgaGvveevGegVtgvkpGdrVvllfllscgeCryClsgrenlCenlglngvgllgdgterftadgkl
00472351   1/1  GHEgaGiVeevGegVtglkvGdrVvllflisCgeCryClsglenlCenlralgllgvl..gggaerl---
00478461   1/1  GHEfvGeVvevGsdvtnlkvGdrVvvpflisCgeCryCkagltslCenlnlglagallGyldlggldGgq
00374371   1/1  ---------------------------------------------------agrlavleaalllervltg
00423401   1/1  ---------------------------------------------------aGylavllaalllcrflgg
00484691   1/1  ------------------------------------------------------------------Dgig
00421801   1/1  ------------------------------------------------------------------Dgig
00422071   1/1  ----------------------------------------------------------------------
00480351   1/1  ------------------------------------------------------------gllldtallv
00385591   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00446051   1/2  ve..sgvpgfkvGdlVvgl...............ggwaeyavvdadlllklpdllaeg------------
00367431   1/1  GHegaGivesvGegvtsvkpGdhvvllflpeCgeCklClsgktnlCeklrllglallgkgllldgtsrfs
00387841   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00472761   1/1  ---------------------------------------------------------------ysrplll
00361941   1/1  ----------------------------------------------------------------------
00479191   1/1  -----------------------------------------------------------------Ydlgn
00496711   1/1  -----------------------------------------------------------nsvsglfdsia
00348721   1/1  -----------------------------------------------------------fhpinvgdlvt
00511831   1/1  ----------------------------------------------------------------------
00467441   1/1  --------------------------------------------------------------ikrlvvll
00484901   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00484141   1/1  -----------------------------------------------------------------dyigl
00376621   1/1  ----------------------------------------------------------------------
00465291   1/1  ---------------------------------------------------------------Pctplgv
00532871   1/1  ----------------------------------------------------------------------
00519911   1/1  ---------------------------------------------------------------------l
00527221   1/1  ----------------------------------------------------------------------
00468011   1/1  ----------------------------------------------------------------------
00509551   1/1  ----------------------------------------------------------------------
00517631   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00416921   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00509671   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00450761   1/1  -------------------------------------------------------------------llv
00354711   1/1  ----------------------------------------------------------------------
00352901   1/1  ------------------------------------------fgalnlgrlllgl....lglvpctplgi
00413661   1/1  ----------------------------------------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00513551   1/1  ----------------------------------------------------------------------
00510931   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00451531   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00520851   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00510061   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00528071   1/1  -------------------------------------------------fdsyayfydalnllqlrprte
00515111   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00498451   1/1  ----------------------------------------------------------------------
00369221   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00514401   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00506551   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00483611   1/1  ----------------------------------------------------------------------
00471241   1/1  ----------------------------------------------------------------------
00512031   1/1  ----------------------------------------------------------------------
00512791   1/1  ----------------------------------------------------------------------
00446052   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
00502041   1/1  ylallelaglklspgetvlvhGAaGgVGllavqlAkalGasrViatagseeklellvkelGadevinyke
00487991   1/1  ylalveraglkpgetVlvtgaaGgvGlaavqlAkalGarviatagseeklelakelGadhvinykdedfv
00512641   1/1  ylalvelaglkpgetVlvhGAaGgvGlaavqlAkalGarViatagseeklelakelGadhvidyrdedlv
00474811   1/1  ylalv.raglkpgdtVlvtGAaGgvGlaavqlakalGarViatdrspeklelakelGadhvidyrdedl.
00502031   1/1  yhalveraglkpgdtVlvlGa.GgvGllavqlakalGasrViatdrspeklelakelGadhvinykdedl
00508891   1/1  gl..ylallralggllk.ge--------------------------------------------------
00500401   1/1  ylallelaklkpgetvlvhgAaGgvGsaaiqlakalGarviatagsdeklellkelGadhvinykeedfv
00462531   1/1  yhalvrragvkpgdtVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadhvinykdled
00512631   1/1  ..........agllkpgetv.v------------------------------------------------
00513271   1/1  yhalvr.aglkpgdtVlviGa.GgvGllaiqlakalGagrViatdispeklelakelGadhvinyrdedl
00476551   1/1  yhal.rlagvkpgdtVlvlGa.GgvGllavqlAkalGasrViavdgspeklelakelGadhvinykdedl
00476541   1/1  klPldglslee...llcagltayllllalle---------------------------------------
00417381   1/1  ylaLvalarlklgpkl------------------------------------------------------
00508901   1/1  ylalfalleraglkpgetvlvtGAaGgvGslavqlAkalGarViatagseeklellrelGadevidyk..
00488621   1/1  vvvpadllvklPdglsleeaa-------------------------------------------------
00488631   1/1  yhalv.ragvkpgdtVlviGa.GgvGllavqlAkalGarViavdrseeklelakelGadhvidykeedlv
00481071   1/1  yhallrragvkpgdtVlvlGa.GgvGllavqlAkalGasrviavdlsdeklelakelGadhvinykdede
00485161   1/1  ylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavdrseeklellkelgadvvidvtde
00486731   1/1  yhalvrragvkpgdtVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadevinykdedk
00467251   1/1  yhalvrragvkpgdtVlvlGa.GgvGllaiqlAkalgasrViavdlseeklelakelGadhvinykdedl
00479941   1/1  klPdg.................------------------------------------------------
00408171   1/1  ggvlldggfaeyvvvpa-----------------------------------------------------
00461131   1/1  kslltldGlsgfaeyvvvparllvkilPdglslee...................................
00496851   1/1  ...........................Vaiql--------------------------------------
00474801   1/1  aylallelaglkp...vlvl--------------------------------------------------
00405511   1/1  yhallr.agllpgktvlvtGa.GgvGlaaaqlaaalGarViavdrseeklelarelgadvvidvtdedlv
00432751   1/1  lslelaalleplavtahaal--------------------------------------------------
00397791   1/1  vklpdglsleeaallep-----------------------------------------------------
00461141   1/1  yhalvrragvkpgdtVlvlGa.GgvGllavqlAkalgasrviavdlspeklelakelGadhvinpkdede
00423651   1/1  paanlvklpdglsleeaalleplavta-------------------------------------------
00486721   1/1  pllgflgdGgfaeyvvvpernlvkidPdgl----------------------------------------
00429051   1/1  ltaysalrr.aglkpgesl---------------------------------------------------
00500011   1/1  nlvklPdglsleeaalllca--------------------------------------------------
00467241   1/1  glllglGgfaeyvvvpadllvkllPdglsleea...............----------------------
00502021   1/1  faeyvvvdp-------------------------------------------------------------
00432761   1/1  vlavla.agvkpgktvlvlGa.GgvGlaaaqlakalGakVvavdiseeklelakelGadfvvvykdedva
00387111   1/1  yvglleiakvkpgetVlvlGa.GgvGllavqlaklaGagrviavdgsdeklelakelGadavvnykdled
00429061   1/1  -------aklkpgktvlvtGAaggvGlaaaqlakalGarViatarseeklellkelGadvvidykdedlv
00382671   1/1  ...aalltlaaltalkaireletlydlllslg--------------------------------------
00450921   1/1  lPdelddeaaalleplsvtalrslvkrlavtpaka-----------------------------------
00464491   1/1  Pdglslelaalleplllatalhave---------------------------------------------
00397801   1/1  ayaalkraglkpgdtvlvvGaaGgvGllavqlakalgaarviavdlsdeklelakelgadhvinskeedl
00471041   1/1  dglldleeaallleallta---------------------------------------------------
00383791   1/1  lealkrallelkpgsrVlviGa.GgvGsaaaqllaaaGvgkvilvDrdeealerarrlgpdvvvdpie.d
00385671   1/1  liglvevaklkpGktvlvlGl.GgvGllalllakaaGagrvigvdindeklelakelGathvvnyketek
00367461   1/1  lhal.lraglvpGktVlviGa.GgiGlaaalaakalGakViatdrspekleqakelgadfvvvykdlsed
00472321   1/1  gkllghllgqssfaeyavvdelsvvkvdllkddlpl...llaal--------------------------
00471811   1/1  gklllhflggssfaeyavveeas..vvkvdadlpllkag..llg--------------------------
00463141   1/1  pvlhflglssfaeyavvee---------------------------------------------------
00423661   1/1  vralllagv.lpgakVlvlGa.GvvGlqaaalakalGageVtvvDisperleqaeelGadlvvvpseedl
00367441   1/1  fllllelagvlpgktVlvfGl.GgvGlaaillakaaGagrviavdlndeklelakslGadlvvnpkdlde
00445261   1/1  wlplll.agllpgktvgviGl.GgiGlavarlakalGarViaydrspeklelakelgadfvvvysdedsl
00496861   1/1  ylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelgadvvldvt..dve
00470591   1/1  yllltdfvdlkpGndwviqnaansavGklviqlakllGlktinvvrdrpdleelvdeLkalGadvvitee
00462521   1/1  lghflglssfaeyavvdev---------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00478461   1/1  AeyvrvpladvlllklPdglsldeal.llladvlp-----------------------------------
00374371   1/1  lgal...agllpgkrvlViGa.GgiGleaAaalarlGakVtvvdrrpellerleelgakfvlltldeelv
00423401   1/1  lgllltlagglagkkvlviGa.GgvGlaaarllaalGakVtvldrnpekleqleelgadav.........
00484691   1/1  avsllkrlgvdlpgkrvlviGa.Ggagraaalallalgaevtvvnrtlekaeelaelladevvaldlddl
00421801   1/1  avsllkrllvdlpgkkvlvlGa.GgiGralalalaaagaevvvvnrtlekaeelaeelgaqgdvsdleel
00422071   1/1  -------------mkVgivGAtGrvGrllvrlllahpgvevvavvsraeaaellkllgadvvvdatppdv
00480351   1/1  llllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrneeklealaaelgalg....ralav
00385591   1/1  -----------egkvvLVtGgsggiGraiaralaaaGarVvvvdrseeal................gggv
00424291   1/1  ------mmlslkgkvvlvtGasggiGralaralaaaGarVvlldrseekleelaaelgrvlavvlDvtde
00446051   1/2  ----------------------------------------------------------------------
00367431   1/1  lkgkpvlhflglstFa------------------------------------------------------
00387841   1/1  -------------kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlg......gg
00502281   1/1  ------------mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnepgvevvegdltdpd
00472761   1/1  gligllgakvlpgkkvaviGa.GgvGlalAlalaaagaagevtlvDideekleglardlldilellgv..
00361941   1/1  --------mdlkgkvalvtGasggiGraiaralaaaGarVvlldrneekleelaaelg..........rv
00479191   1/1  dlyellldedyfysdayyddpgdllrpaqerllelllellglkpgkrvLDiGc..GtGglalalakalga
00496711   1/1  shydllndlyellldedyfysygyfddyglglrpaqeallelllellglkpgkrvLDiGc..GtGglala
00348721   1/1  gllfdnllpctpsgvlellkatgidlaGkvavVtGasrgiGraiallLaaagatVtvcdrdted...lee
00511831   1/1  --llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggdpgvelvv
00467441   1/1  vlkglllsrlladalilvprhydlgedlygeelakvyddlaafldglrsrqeallelllellglkpgkrv
00484901   1/1  -lllldkllkllkpgdlvllllannlllpltlrvnklkltrfgllnvlelsgknavahydlsndvyelll
00486141   1/1  -----------kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealae..........gggalava
00484141   1/1  vnllkklgldlkgktvliiGa.GgvGlaiaqalaalGakkVvlvdrdeekaqalveqlkelgskikvkav
00376621   1/1  --llllmllslkgkvalvTGassgiGraiAralaaaGarVvltdrneekleelaaeleal..ggrvlava
00465291   1/1  llllellgillllllmmlrlkgkvalVtGassgiGralAllLareGatVvvvdrneekleelaeeieaag
00532871   1/1  -----------lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspekleelgg.gvevvvgDltd
00519911   1/1  llllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleelaaegvevvvgDltdp
00527221   1/1  -llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaaegvevvvgDltdp
00468011   1/1  ------------gkvalvTGassgiGraiaralaaaGarVvlldrneek...................vq
00509551   1/1  ---lllmlldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaeleallpggrvlava
00517631   1/1  --mldlkgkv.....alvtGassgiGlaiaralaaaGarVvlldrneekleelaae...........grv
00471781   1/1  -------------mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaallglg.vevvvgDlt
00416921   1/1  ---------dlkgkvalvtGassgiGraiaralaaeGarVvltarneekle.......ggralavvlDvt
00476811   1/1  -----------kgkvalvTGassGiGlaiAralaaaGarlllVvltdrneekleelaaelrallpsggrv
00509671   1/1  -----------dlkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvl
00430411   1/1  ------------MsgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaapgve
00481861   1/1  -------------kkvlvtGAsGgiGsalalllaargaevvlldrspeklegvaldlsdlgvevvvadlt
00380681   1/1  ------------gkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaeleal...ggrvlav
00450761   1/1  lllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseekleelaaelealgg..rvlav
00354711   1/1  ---Ms.....lkgkvvlvTGasggiGralaralaaaGarVvlldrseekleelaael.ggrvlavalDvt
00352901   1/1  lellerlgidlsgkvalVtGasggiGraiallLaraGatVtvtdrntenleeavke.............a
00413661   1/1  -------mmdlkgkvalvtGassgiGlaiaralaaeGarVvlldrneekleelaaelggrvlavalD...
00503651   1/1  ---------slkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaa---------------
00421311   1/1  -----------kgkvalvTGassgiGraiAralaaeGarVvltdrnseekleelaaeleallggralava
00387701   1/1  -------mmdlkgkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaael.ggrvlavalD..
00437031   1/1  --------mdlkgkvalvtGassGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlav
00513551   1/1  -----------lkgkvalvTGasggiGlaiaralaeeGdlakVvlldrneekleelaaelggrvlfvqlD
00510931   1/1  --llllmlldlkgkvalvTGassGiGraiAralaaaGarVvltarneekleelaaelralggd.rvlava
00385451   1/1  --------ldlkgkvalvTGasggiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalD...
00451531   1/1  -----psllslkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaa---------------
00368061   1/1  ---------dlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaael.ggrvlavalD..
00425341   1/1  ------lsmvlkgkkvaviGa.GliGlalalllallglgeVvlyDinpekleglaadladilelllvk..
00367851   1/1  ------------kgkkvlviGa.GgiGralaraLaeaGaevtvadrslekaealaael.ggveavelDvt
00520851   1/1  ---llsllsllkgkvalvtGassgiGlaiAralaaaGarVvltdrsaekleelaa---------------
00474701   1/1  -----------dlkgkvalvtGassgiGlaiAralaaeGarVvltdrneekleelaaelealggkarvla
00464831   1/1  ------------sgkvalvTGassGiGlaiAralaaeGakVvlltdrneekleel---------------
00533831   1/1  ------lellgvallevlgkrilkgkkvaviGa.GgvGlalAllllelgvaaeVtlvDiddelleglale
00425051   1/1  -------------kvalvTGassgiGraiAlalaaeGarVvltdrneealeela........ggkalava
00460341   1/1  ------------gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspek---------------
00510061   1/1  ---mslkgkv.....alvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlav
00394381   1/1  -------mmslkgkvalvTGassgiGraiaralaaaGarVvltdrsgeekleelaaeleal..ggrvlav
00383421   1/1  ------pslslkgkvalvTGasgGiGralaralaarGarVvlldrsglssllllsaekleelaael.ggr
00528071   1/1  alleallellglkpgkrvLDlGc..GtGglalalakr.gakrvtgvDisp.mlelarenaaenglpnrve
00515111   1/1  ----------LkgkvalvTGAssGiGraiAralaalleegarVvlvarneekleelaaeleallpggrvl
00398711   1/1  --------mdlkgkvalvTGassgiGraiaralaaaGarVvlldrneekleelaael.ggrvlavalDvt
00498451   1/1  ------------gkvalvTGassgiGralaralaarGarVvlldrsee.ggrvlavaaDvtdeesvealv
00369221   1/1  ------------gkvalvTGassgiGlaiAralaaaGarVvlldrsgaekleela---------------
00350181   1/1  -------mmdlkgkvalvTGassgiGlaiaralaaaGarVvlldrneekleelaaelral...ggrvlav
00514401   1/1  ------------gsslldmldlkgkvalvTGasggiGraiAralaaaGarVvlldrneekleelaaelea
00493571   1/1  -----------llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaae
00506551   1/1  -----------sGmkvalvTGassgiGlaiaralaealGakVvltdrneekleel---------------
00388141   1/1  --------ldlkgkvalvTGassgiGraiaralaarGarVvlldrseekleelaael.ggrvlavalDvt
00483611   1/1  ------------GkvalvtGasnesgiGraiAlalaeeGakVvitdrneealeelaaeleallseellle
00471241   1/1  ----llmllslkgkvalvTGassGiGlaiAralaaaGarVvltdrseekleelaa---------------
00512031   1/1  -----------dslsllslkgkvalvTGassGiGraiAralaeeGarVvltdrneekleelaaelealgg
00512791   1/1  -----------lldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaelg..rvlava
00446052   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
00502041   1/1  edlvealkeltg............ggvdvvldtvggetleaaldalapgGrivliglasgyvleldllll
00487991   1/1  eavlelt...........ggrgvdvvldavggetleaaldllapgGrvvlvGlasgailplpllllllkg
00512641   1/1  eavkeltg............grgvdvvldtvggetleaaldllapgGrlvlvgllsg..lpldllllllk
00474811   1/1  ...............altggggvdvvldtvgg.tleaaldllrpgGrlvlvgllsggplplpllllllkg
00502031   1/1  ldlveavkeltg............grgvdvvldavggpatleaalellrpgGrlvlvgvlsgpllllplp
00508891   1/1  ----------------------------------------------------------------------
00500401   1/1  eevleltgg...........egvdvvldnvggetleaslkllapgGrivviGlasgynlelpvlplllkg
00462531   1/1  lveavkeltg............grgvdvvidavggeatleaalelllrpgGrivlvGvpggpllplplll
00512631   1/1  ----------------------------------------------------------------------
00513271   1/1  veavleltggr...........gvdvvidavggeatleaalellkpgGrivlvgvlgggnllelplplll
00476551   1/1  veavleltgg...........rgvdvvldavggeatleaalellrpgGrivlvgvlggglllplplplll
00476541   1/1  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00508901   1/1  dlveevleltg...........gegvdvvldtvggetleaalallapgGrvvligllsgaplpldllpll
00488621   1/1  ----------------------------------------------------------------------
00488631   1/1  aell...............gggvdvvldtvggpleltleaalellrpgGrlvlvGlpggplp.ldlllll
00481071   1/1  dlveavkeltg............ggvdvvldavggpatleaalellrpglGrivlvGvpggplpllplll
00485161   1/1  daveal...............agggvdvvvnnaggatlgallellapggrvvlvnllggllltral....
00486731   1/1  dlveavkeltg............ggvdvvldavggpatleqalellrpglGrvvlvGvpggplpllplll
00467251   1/1  veavkeltg............ggvdvvldavggpatleaalealrpgGrlvlvGvlggplllpldlllll
00479941   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00461131   1/1  ......................................................................
00496851   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00405511   1/1  eavlelt.............ggvDvvvdaagvpatleealrllkpggrlvlvgvagg.llpldlarlllk
00432751   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00461141   1/1  dlveavkeltg............ggvdvvleavgapaaleqalellrpggGrvvlvGvpggplp.lplll
00423651   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00432761   1/1  eavleltg.............gadvvidtagipgilreilrllkpggvivllgllpg.plplpladlllk
00387111   1/1  laealkeltg...........gegvdvvldnvggeeallaalrlllkpgGrvvlvGvisgyvlplpllel
00429061   1/1  ealkeltg............grgvdvvlnnvggetldaaldllapggrvvlvglisgynlpllllllllk
00382671   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00397801   1/1  veevleltg...........grgvdvvldavgaeatlelaldllapgGrlvlvGllgg.lleldllllll
00471041   1/1  ----------------------------------------------------------------------
00383791   1/1  laeallellgg...........rgvDlvldcvdnfetlallidalkpggipvvsgagag..gqldpteil
00385671   1/1  vaeevkeltdg...........egvdvvieavgspqtlreaisvlkkpgGtvvlvgvpsgplellpivll
00367461   1/1  iieavaellatng.........ggadividtagipgileeavdllkpggvivdvgladg.eltvplllvl
00472321   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00423661   1/1  aeavreltg.........kqgggaDlvitaagipgvlrealevmkpggvvvdvaidqg.eltlplttlvl
00367441   1/1  evaeavleltg............ggvdvvveavgsvqallqaidavrpgwGtvvlvGllgkelelplv..
00445261   1/1  eel................lkgaDvvilhvpltlaleevlellkpggvvvdlgaltgglinaevlalmkk
00496861   1/1  ellkallk...........lggvdvvihtagapvtelslsllkqllrvnvlgtlnllrallpllvklgvk
00470591   1/1  elldedlkkllkeltkg.........ggeevklalnavGGksatallrlLspggllvtyGglskepvtlp
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00374371   1/1  evvlaltvdvsdeegrlkavetleellgeaDvvivaagippataplllteellelm--------------
00423401   1/1  ......evdvsdtadleelvaeaDvvinaagipgatapllvtrellelmkpgs-----------------
00484691   1/1  eeal.................ggaDlvinatgagmaglvlplllsllkpggvvvdvgy....pplitpll
00421801   1/1  eeal.................ggaDivvnatgaglpglllelllellkpggvvvd---------------
00422071   1/1  laelaea...........llkagvdaVilsaGfrlsdlllve----------------------------
00480351   1/1  aadvtdpesvealv.......ggldilvnnagilgallgplldltledwervldvnllgt----------
00385591   1/1  lavaaDvtdeeavaalvaaavellefggldvlvnnagilavgeplldlsledwdrvldv-----------
00424291   1/1  esveaaveel..........ggldvlvnnagiallgplldlsledfervldvnllgtfl-----------
00446051   1/2  ----------------------------------------------------------------------
00367431   1/1  ----------------------------------------------------------------------
00387841   1/1  alvlvadvtdleavedlvealggadvvvnnagvprkpgeerldllevnvlgtknlaealkkagpg.rivv
00502281   1/1  dlekalk.................gvDvvihaagtsrvde------------------------------
00472761   1/1  ..........glvvttdleealkgaDvviia---------------------------------------
00361941   1/1  lavvlDvtdeesveaaveelggldvlvnnag---------------------------------------
00479191   1/1  rvtgvDispemlelareraaelglpnrvefvvgDaedl.................dgsfDlvvsnavlhh
00496711   1/1  lakalgarvtgvDispemlelarenaaelglpnrvefvvgDaedl.................dgsfDlvv
00348721   1/1  lvkeadivvtavg---------------------------------------------------------
00511831   1/1  gDltdpesleaale.................---------------------------------------
00467441   1/1  LDlG..cGtGglalalakllgagrvtgvDispealelarenaaglpn.vefivgDaedplpdllee....
00484901   1/1  dpaysdslarfgegntllqpelaelllelldlkpgkrvLDiGc..GtGglalalakllgpdarvtgvDi-
00486141   1/1  aDvtdeeavealveaaveafggldvlvnnagillplgplldlsledwdrvldvnllgtf-----------
00484141   1/1  sldvgdveele...........ellgkvDivi--------------------------------------
00376621   1/1  lDvtdeesvealveaileefgrldilvnnag---------------------------------------
00465291   1/1  gkavvldvsdeedlkelv...........gr---------------------------------------
00532871   1/1  pdslaaala.................gvdav---------------------------------------
00519911   1/1  eslaaalk.................gvdvvi---------------------------------------
00527221   1/1  eslaealk.................gvdvvi---------------------------------------
00468011   1/1  lDvtdeesvealveavleefggrldilvnnA---------------------------------------
00509551   1/1  lDvtdeesvaalvaavleefgrldilvnnAg---------------------------------------
00517631   1/1  lavalDvtdeesvealveefgrldilvnnag---------------------------------------
00471781   1/1  dpaslaaala..............gvdaVihlagpadpldllevnvdgt---------------------
00416921   1/1  de..........veaaleafgrldilvnnag---------------------------------------
00476811   1/1  lavalDvtdeesvealveav.efgrldiLvn---------------------------------------
00509671   1/1  avalDvtdeesvealveevleefgrldilvn---------------------------------------
00430411   1/1  vvegDltdpeslaealk.................gvdvVihl----------------------------
00481861   1/1  dpeslaealk....................g---------------------------------------
00380681   1/1  alDvtdeesvaalveavleefgrldilvnna---------------------------------------
00450761   1/1  alDvtdeesvealveavleefgrldilvnnA---------------------------------------
00354711   1/1  ....deesveaaveavleefggldvlvnnAg---------------------------------------
00352901   1/1  Divivavgvpglvkaellkpgavvidvdvtdpedvealgdvaleefggvdilvnnapggvgpmtvallld
00413661   1/1  ..vtdeesvealveavleefgrldilvnnag---------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00421311   1/1  lDvtdealaeeleelelllllllesvealve---------------------------------------
00387701   1/1  ..vtdeesvealveavleefgrldilvnnAg---------------------------------------
00437031   1/1  alDvtdeesvealveavleefgrldilvnna---------------------------------------
00513551   1/1  .....vtdeesvealveeileefgrlgldil---------------------------------------
00510931   1/1  lDvtdeesvealveavleefgrldilvnnAg---------------------------------------
00385451   1/1  ..vtdeesvealvaealeefgrldilvnnAg---------------------------------------
00451531   1/1  ----------------------------------------------------------------------
00368061   1/1  ..vtdeesvealveaaleefgrldilvnnAg---------------------------------------
00425341   1/1  ........grirattdlyealkgaDvviiavgvprkpg--------------------------------
00367851   1/1  deasldaal.................gdaDv---------------------------------------
00520851   1/1  ----------------------------------------------------------------------
00474701   1/1  valDvtdeesvealveavleefgrldilvnn---------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00533831   1/1  lgdiisllgk............alkvdtdde---------------------------------------
00425051   1/1  lDvtdeesvealveaaveefgrldiLvnnag---------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00510061   1/1  alDvtdeesvealveavleefgrldilvnna---------------------------------------
00394381   1/1  alDvtdeesvealveavleefgrldilvnna---------------------------------------
00383421   1/1  vlavalDvt....deesvealveaaleefgr---------------------------------------
00528071   1/1  fivgDaedl..............plpdgsfDlvvsnplpfvlhhlpdleallreaarvLkPGGrlvlstp
00515111   1/1  avalDvtdeesvealveavlellleefgrld---------------------------------------
00398711   1/1  ....deesvealvaavleefgrldilvnnAg---------------------------------------
00498451   1/1  aaale.fgrldil---------------------------------------------------------
00369221   1/1  ----------------------------------------------------------------------
00350181   1/1  alDvtdeesvealveavleefggrldilvnn---------------------------------------
00514401   1/1  elplllggrvlavalDvtdeesvealveeil---------------------------------------
00493571   1/1  lealggslllggvefvqgDltdpesleaala---------------------------------------
00506551   1/1  ----------------------------------------------------------------------
00388141   1/1  ....deesvaalvaavleefgrldilvnnag---------------------------------------
00483611   1/1  leelleleelleleaaleeledleggkalav---------------------------------------
00471241   1/1  ----------------------------------------------------------------------
00512031   1/1  gkvlavalD....vtdeesvealveeileef---------------------------------------
00512791   1/1  lD....vtdeesvealveavleefgrldilv---------------------------------------
00446052   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LQVRGSNGWERDDIEKLFALLASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP-----------
00502041   1/1  lllllllllllkgltllgfllgslp---------------------------------------------
00487991   1/1  ltllgsllgsrldlrellllvalgkilplvlithlleleea-----------------------------
00512641   1/1  gltllgsllgtlllelleelldllaegkl-----------------------------------------
00474811   1/1  ltllgsllgsr.lleelldllaegklkpvilitf------------------------------------
00502031   1/1  llllllkgltlvgsllgtredleelldllas---------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00500401   1/1  ltllgillgsrllvldllll--------------------------------------------------
00462531   1/1  lllkgltilgslvggredlpelldlla-------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00513271   1/1  lllkgltlvgsllgtraelleeald---------------------------------------------
00476551   1/1  lllkeltllgsllgtredlpellell--------------------------------------------
00476541   1/1  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00508901   1/1  lkgltllgsllgtrllllelllllllglll----------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00488631   1/1  lkgltilgslvgsradleelldlvaeg-------------------------------------------
00481071   1/1  lllkeltllgslvggrlvleelpel---------------------------------------------
00485161   1/1  ...................lplllkrgkgrivnsskaalegltealalelagkgig--------------
00486731   1/1  lllkgltllgslvgsraprdlpell---------------------------------------------
00467251   1/1  lkeltllgsllggrlpleelpelle---------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00461131   1/1  ...........................................................-----------
00496851   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00405511   1/1  gvnlrgsflgtraalpellellagg---------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00461141   1/1  lllkeltllgslvggrrdleellel---------------------------------------------
00423651   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00432761   1/1  gvtiigslvggrellaellellaegll-------------------------------------------
00387111   1/1  llkrltlrgfivg---------------------------------------------------------
00429061   1/1  gltllgfl--------------------------------------------------------------
00382671   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00397801   1/1  keltil----------------------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00383791   1/1  lkglsvrglfvlpredleellelll---------------------------------------------
00385671   1/1  vlssktvrgslvggr......................vpleelpealkrl--------------------
00367461   1/1  lkgvtivgsvvl.rllleealellae--------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00423661   1/1  kgvtvvgsvvl.vanlpgavdllasgl-------------------------------------------
00367441   1/1  lvlngltlrGs-----------------------------------------------------------
00445261   1/1  gatlintargglvdeeallealasgk--------------------------------------------
00496861   1/1  rivyissvgvvtplrglsp---------------------------------------------------
00470591   1/1  tsllifkdltlrGfwltkwlkedpe---------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00484691   1/1  alaravglrltvdglemlveqaalafelwtgilppvelirea----------------------------
00421801   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00446051   1/2  ----------------------------------------------------------------------
00367431   1/1  ----------------------------------------------------------------------
00387841   1/1  vsspa-----------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00479191   1/1  lpledleallrelarvLkPGGrlvlstpnrdgl-------------------------------------
00496711   1/1  s.navlhhlpvedpeallrel-------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00467441   1/1  .......gsfDlvvsd.lph--------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00376621   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00468011   1/1  ----------------------------------------------------------------------
00509551   1/1  ----------------------------------------------------------------------
00517631   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00416921   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00509671   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00450761   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00352901   1/1  nt--------------------------------------------------------------------
00413661   1/1  ----------------------------------------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00513551   1/1  ----------------------------------------------------------------------
00510931   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00451531   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00520851   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00510061   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00528071   1/1  sppgleellellrallle----------------------------------------------------
00515111   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00498451   1/1  ----------------------------------------------------------------------
00369221   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00514401   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00506551   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00483611   1/1  ----------------------------------------------------------------------
00471241   1/1  ----------------------------------------------------------------------
00512031   1/1  ----------------------------------------------------------------------
00512791   1/1  ----------------------------------------------------------------------
00446052   2/2  -----------dlllklpdllaeglklklresvalgllgapealtgllgglnigklvvk-----------