[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38511.1


[Show Plain Result]

## Summary of Sequence Search
   1::795
 533::707    1e-35 32.6% 0050199 00501991 1/1   ouridine synthase                       
 535::707  5.4e-33 33.5% 0047872 00478721 1/1   ouridine synthase                       
 519::705  2.3e-29 26.7% 0042443 00424431 1/1   ouridine synthase                       
 451::576  6.6e-27 36.6% 0037616 00376161 1/1   -L RNA-binding motif                    
 477::576  7.4e-25 40.4% 0035794 00357941 1/1   -L RNA-binding motif                    
 507::697  9.2e-24 28.7% 0051811 00518111 1/1   ouridine synthase                       
 533::697  1.7e-23 29.7% 0050102 00501021 1/1   ouridine synthase                       
 494::687  4.7e-17 21.2% 0052542 00525421 1/1   ouridine synthase                       
 532::713  2.1e-15 22.4% 0043606 00436061 1/1   ouridine synthase                       
 475::542  9.5e-15 39.7% 0039540 00395401 1/1   -L RNA-binding motif                    
 476::534  3.3e-12 47.5% 0047871 00478711 1/1   -L RNA-binding motif                    
 475::532  5.2e-12 48.3% 0044787 00447871 1/1   -L RNA-binding motif                    
 532::721  1.2e-10 22.2% 0039976 00399761 1/1   ouridine synthase                       
 533::713  5.1e-10 20.8% 0043107 00431071 1/1   ouridine synthase                       
 456::533  9.8e-10 29.5% 0042206 00422061 1/1   -L RNA-binding motif                    
 459::524  1.5e-09 34.8% 0047115 00471151 1/1   -L RNA-binding motif                    
 472::562  3.8e-06 28.9% 0036496 00364961 1/1   -L RNA-binding motif                    
   1::795


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRDTDKNNASARGRRDRPGGGKTSSGGKGGFGGKGGFGGKSAGGGKGRSGAARGPEKKFAKRGEGTFEA
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RADKPFAKKTFGGDAKRAFGGEGKRPYVKRDGAAPRRDFADRPRRDDGDAPRPRFNRDERPARSGGDRPE
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RGPRKEFGEKRAFAPREGGEKRPYTPRPPRDDRGGDRPFKRDDRAPRRDRGDDARPAGRFGDKKFGDKKF
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEKRPYTPREGGDKRPYTPREGGEKRPYTPREGGEKRPYAAREGGEKRPYTPRDGGEKRSYAPREGGDKR
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PYTPRGEGFRKDGERSRPTGDRPFGARPSRDGKFGGDKKFGRGAPDRGPRKDFGSRPDRGGDRGDAKPWQ
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KRDGDSAERGRSFDKPRFDKPREERGGDRPRFSRDDRPKFERRERTGDWHEHPRNEGPSSDRPRSRDNGE
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RGFDRPRRENEDESKIFAKRPAFGGRGAYRERPKTDRSKTERRAAPAPAKADKAGDRIAKVVARAGLCSR
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ------------------------------krylgPklklirrlgrellltgkygllnkkellkreyppg
00357941   1/1  --------------------------------------------------------kklseyglqlrekq
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ------------------------------------------------------eirLdklLvraglakS
00478711   1/1  -------------------------------------------------------lRLdkflaelgllsR
00447871   1/1  ------------------------------------------------------gmRLdkflarlglasr
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  -----------------------------------rllkgelpddllevelsdeyirLdqlLklaglaes
00471151   1/1  --------------------------------------dglPdvllellllleegirldklLvraglakS
00364961   1/1  ---------------------------------------------------ellemRLDkvlyragfakt


                         *         -         -         -         -         +         -:560
query           RDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLYHKPRGLMTTHADPEGRPTVF
00501991   1/1  ------------------------------------------edddllvlnKPagllvhpgdgl.rgtll
00478721   1/1  --------------------------------------------ddllvlnKPagllvhpgdglgr.tll
00424431   1/1  ----------------------------eellvevlgldilyededllvlnKPagllvhpgdgllrgtll
00376161   1/1  qhgqlarkklslyllqlrekqklrffygllerqllryfklarklkgvtglnllqlLErRLdkvlfrlgfa
00357941   1/1  klrffYgltekqllnyfkealklkgvtglnllqllerRLDkvlarlglaksrrqArqlilhGhVlVngkv
00518111   1/1  ----------------glvlelglkvdpeldvlvlgrplklllldgvllldKPagvtShdvvakvr.rll
00501021   1/1  ------------------------------------------edddllvlnKPagllvhpgdgllrgtll
00525421   1/1  ---dllllklllkvlgkllvlvllltplglgvlpedrplkvlyedgllvldKPagltshdvvgkvkrtl.
00436061   1/1  -----------------------------------------yeddgllvldKPagltshpvvgklrrll.
00395401   1/1  rreArrliqagaVlvngekvtdpgykvdpgdlievdglllrvgkkkflllll------------------
00478711   1/1  seakklikagrVtvngkvvtkpslkvkpgdvitvdgellellel--------------------------
00447871   1/1  seakklieagrVlvngkvvtkpsykvkpgdvievdgkllepl----------------------------
00399761   1/1  -----------------------------------------yllngillldKPagltshdvvallkrll.
00431071   1/1  ------------------------------------------llnglllldKPsgltshdvvallkrll.
00422061   1/1  ggeAkrliaeggVkvdGevvtrrglkvragdvvevagkrlfvv---------------------------
00471151   1/1  rsearrlikqggvrvngevvtdpglkvllgdviv------------------------------------
00364961   1/1  rslArqlvehGhvlvnGkrvk.Psylvkvgdvitvregskellvvvlallelrrgapealllyeeklegl


                         -         -         -         *         -         -         -:630
query           DNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPETGWLRRYRVRAHGEVTQAQLDQLASGVEVD
00501991   1/1  dlllallglrlylvhRLDkdTsGllllakdgelarrllfpkrkveKtYlalvlgvlteellglldlgvll
00478721   1/1  dlllalllprlypvhRLDrdTsGllllakdgeaarrllfpkrkveKtYlalvagvlteellgtldagvvl
00424431   1/1  dlllallgdlggllrlypvhRLDkdTsGllllakdgeaarrlseqfpkreveKtYlalvegvppedglid
00376161   1/1  sSrrqArqlInhghVl------------------------------------------------------
00357941   1/1  vdkpsykVkpgdvitv------------------------------------------------------
00518111   1/1  dll.....kvghvGtLDplatGvLllalgg..atkllsplldvdKtYlatvrlvgliteealekllagft
00501021   1/1  dlllallglprlypvhRLDrdTsGllllakdgeaarrlselfperkveKtYlAlvagvpeeeegtilapl
00525421   1/1  .....glkkaghvGtLDplasGvLvvalge.atklvkyl.ldvdKeYvalvrlgvatdtgdlegeileft
00436061   1/1  .....gvkkvghvgrLDpdtsGvLvlalgg..atkllsyllkvdKtYlalvllglatdtgdidgeiletl
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  .....gvkkvghaGtLDplatGvLllalge..atkllsylldadKtYvatvllGlatdtldaegeileta
00431071   1/1  .....gvkkvghaGtLDplatGvLllalgk..atkllsylldadKtYvatvllglatdtldaegeileta
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  vl--------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           GVKYGPIEAKLERDQGANVWLVFAIREGKNREVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVKT
00501991   1/1  dgkpaltlyavlerl.g.lslleltlltGrthqiRvhlaalghpilgdkrygignlllgldlhagelrfl
00478721   1/1  dgkpavtlfavlerl..glslleltlltGrthqiRvhlaalghpvlgdkrygignllllgrlalgawrll
00424431   1/1  lplgvllddglklavledgkpavtlfrvlerlgglslveltlltGRtHQiRvhlaalghpilgDplYggl
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  geilqvPpmysavkvdarpvtiyelellefdlplvlle..vtcskgtyiRslaadlGlaLgvgahvl---
00501021   1/1  vrlpdgrlklavvvleggkpavtryrvlerlgglslveltlltGRtHQiRvhlaalghpilgdpryg---
00525421   1/1  geilqvpPlrsavkrdgrrayelarkglevelpllllevtcskG..tyiRslvhdlg-------------
00436061   1/1  grdpltrekiekllasflgeilqvPPlysavkvnGkrlYelaregvevelearkvaitslellefdgplg
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  dvhlteedleealakflgeilqvPPlySavkvngkrlyelareGievelklrlvtiyslellefdgplll
00431071   1/1  dvllteeeiekvlakftgeilqvPPlysavkvnGkrlYelaregievelelrlvtiyelellsfdlplll
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           RVLREQLGEKIIKLAEADFGGPSPSETRPKPRPGKPVAAEDGPAPKKKAVVKRGAVEDRKGRKVKVERTG
00501991   1/1  tplelll---------------------------------------------------------------
00478721   1/1  flhelll---------------------------------------------------------------
00424431   1/1  lllll-----------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  lslvelrvetgrg---------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  levtcskGt..yiRslaedlG-------------------------------------------------
00431071   1/1  levscskgtyiRs---------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           SGDRDPSRGPARRYHGKREPAPRED---------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00424431   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00501021   1/1  ----------------------------------------------------------------------
00525421   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------