[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38586.1


[Show Plain Result]

## Summary of Sequence Search
   1::586
 207::512  1.7e-46 26.2% 0047764 00477641 1/1   /beta-Hydrolases                        
 224::512  3.2e-44 24.5% 0047200 00472001 1/1   /beta-Hydrolases                        
 208::508  2.8e-31 20.1% 0047683 00476831 1/1   /beta-Hydrolases                        
 206::508  3.4e-27 18.6% 0049631 00496311 1/1   /beta-Hydrolases                        
 235::504  8.5e-24 17.4% 0045851 00458511 1/1   /beta-Hydrolases                        
 219::504  2.7e-23 18.4% 0046573 00465731 1/1   /beta-Hydrolases                        
 208::509  2.8e-23 19.0% 0045984 00459841 1/1   /beta-Hydrolases                        
 218::502  3.6e-23 18.6% 0048207 00482071 1/1   /beta-Hydrolases                        
 235::505  6.3e-22 19.0% 0049037 00490371 1/1   /beta-Hydrolases                        
 219::550  1.4e-21 17.6% 0050245 00502451 1/1   /beta-Hydrolases                        
 255::509  1.5e-21 20.4% 0048965 00489651 1/1   /beta-Hydrolases                        
 235::503  2.2e-21 20.7% 0045886 00458861 1/1   /beta-Hydrolases                        
 218::508  2.4e-21 19.7% 0048460 00484601 1/1   /beta-Hydrolases                        
 237::509  9.7e-21 18.6% 0051001 00510011 1/1   /beta-Hydrolases                        
 229::508  1.1e-20 19.7% 0037239 00372391 1/1   /beta-Hydrolases                        
 235::509  1.7e-20 18.3% 0047495 00474951 1/1   /beta-Hydrolases                        
 236::509  6.1e-20 18.2% 0050206 00502061 1/1   /beta-Hydrolases                        
 235::501  1.6e-19 18.6% 0045741 00457411 1/1   /beta-Hydrolases                        
 227::518  1.2e-18 18.7% 0046221 00462211 1/1   /beta-Hydrolases                        
 211::502  1.6e-18 19.6% 0042551 00425511 1/1   /beta-Hydrolases                        
 218::501  1.8e-18 17.7% 0053045 00530451 1/1   /beta-Hydrolases                        
 229::505  1.9e-18 18.8% 0048194 00481941 1/1   /beta-Hydrolases                        
 229::509  2.2e-18 18.9% 0046410 00464101 1/1   /beta-Hydrolases                        
 235::508  3.5e-18 21.1% 0053348 00533481 1/1   /beta-Hydrolases                        
 218::508  4.2e-18 18.2% 0047627 00476271 1/1   /beta-Hydrolases                        
 210::509  4.8e-18 18.3% 0046004 00460041 1/1   /beta-Hydrolases                        
 207::489  1.5e-17 20.4% 0049128 00491281 1/1   /beta-Hydrolases                        
 237::509  1.5e-17 19.7% 0045736 00457361 1/1   /beta-Hydrolases                        
 235::482  2.5e-17 23.6% 0047879 00478791 1/1   /beta-Hydrolases                        
 227::508  6.8e-17 19.7% 0049087 00490871 1/1   /beta-Hydrolases                        
 208::554  1.5e-16 17.2% 0036443 00364431 1/1   /beta-Hydrolases                        
 232::509  3.5e-16 19.3% 0050112 00501121 1/1   /beta-Hydrolases                        
 237::509  4.5e-16 18.4% 0046077 00460771 1/1   /beta-Hydrolases                        
 218::508  8.5e-16 14.3% 0047940 00479401 1/1   /beta-Hydrolases                        
 232::509  1.3e-15 18.8% 0045742 00457421 1/1   /beta-Hydrolases                        
 213::502  2.1e-15 18.8% 0047194 00471941 1/1   /beta-Hydrolases                        
 237::503  6.5e-15 24.3% 0047317 00473171 1/1   /beta-Hydrolases                        
 225::502  9.4e-14 19.4% 0048075 00480751 1/1   /beta-Hydrolases                        
 210::509  1.6e-13 18.4% 0047444 00474441 1/1   /beta-Hydrolases                        
 235::507    4e-13 21.2% 0048982 00489821 1/1   /beta-Hydrolases                        
 205::503  5.2e-13 21.2% 0047388 00473881 1/1   /beta-Hydrolases                        
 229::484  2.3e-12 16.6% 0047592 00475921 1/1   /beta-Hydrolases                        
 178::533    6e-12 17.7% 0048003 00480031 1/1   /beta-Hydrolases                        
 218::501  6.4e-12 18.4% 0048633 00486331 1/1   /beta-Hydrolases                        
 186::504  6.7e-12 20.1% 0039526 00395261 1/1   /beta-Hydrolases                        
 218::508  8.2e-12 18.9% 0047003 00470031 1/1   /beta-Hydrolases                        
 206::508  1.1e-11 18.9% 0047601 00476011 1/1   /beta-Hydrolases                        
 222::398  1.9e-11 18.8% 0046624 00466241 1/1   /beta-Hydrolases                        
 257::398  1.9e-11 22.6% 0046012 00460121 1/1   /beta-Hydrolases                        
 238::398  2.7e-11 18.8% 0048008 00480081 1/1   /beta-Hydrolases                        
 236::525  4.1e-11 18.3% 0044560 00445601 1/1   /beta-Hydrolases                        
 235::501  1.6e-10 19.3% 0042339 00423391 1/1   /beta-Hydrolases                        
 208::529  2.8e-10 19.8% 0046639 00466391 1/1   /beta-Hydrolases                        
 235::395  2.9e-10 16.8% 0047034 00470341 1/1   /beta-Hydrolases                        
 225::395  3.4e-10 21.2% 0047220 00472201 1/1   /beta-Hydrolases                        
 218::508  4.8e-10 19.0% 0047600 00476001 1/1   /beta-Hydrolases                        
 236::503  1.2e-09 20.0% 0049887 00498871 1/1   /beta-Hydrolases                        
 218::508  1.6e-09 21.3% 0049383 00493831 1/1   /beta-Hydrolases                        
 216::503  3.1e-09 18.5% 0046793 00467931 1/1   /beta-Hydrolases                        
 217::501  4.1e-09 20.6% 0049094 00490941 1/1   /beta-Hydrolases                        
 221::554  2.6e-08 18.1% 0048053 00480531 1/1   /beta-Hydrolases                        
 218::508    7e-08 16.6% 0046670 00466701 1/1   /beta-Hydrolases                        
 218::509  8.5e-08 17.3% 0048945 00489451 1/1   /beta-Hydrolases                        
 223::502  1.2e-07 17.3% 0045824 00458241 1/1   /beta-Hydrolases                        
 236::503  4.7e-07 15.7% 0041081 00410811 1/1   /beta-Hydrolases                        
 213::485  6.9e-07 16.5% 0043326 00433261 1/1   /beta-Hydrolases                        
 226::504    2e-06 15.4% 0050226 00502261 1/1   /beta-Hydrolases                        
 220::347  3.5e-06 28.1% 0049637 00496371 1/1   /beta-Hydrolases                        
 250::506  7.3e-06 17.8% 0040046 00400461 1/1   /beta-Hydrolases                        
 208::485  1.5e-05 16.8% 0041193 00411931 1/1   /beta-Hydrolases                        
 202::361  3.3e-05 20.7% 0049591 00495911 1/1   /beta-Hydrolases                        
 258::346    4e-05 24.7% 0046126 00461261 1/1   /beta-Hydrolases                        
 249::509  0.00024 18.1% 0039602 00396021 1/1   /beta-Hydrolases                        
 212::346  0.00059 23.0% 0049638 00496381 1/1   /beta-Hydrolases                        
   1::586


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLQTPSNPIAVAPQAPVRHVGSTDSDRSLHAALAPLTGGLSPTALSLAYADWLSHLFWAPARRLDLAQDA
00477641   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00489651   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00474951   1/1  ----------------------------------------------------------------------
00502061   1/1  ----------------------------------------------------------------------
00457411   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00425511   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------
00464101   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00476271   1/1  ----------------------------------------------------------------------
00460041   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00457361   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00501121   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00471941   1/1  ----------------------------------------------------------------------
00473171   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00474441   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00480031   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00470341   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00490941   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00433261   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00495911   1/1  ----------------------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  ----------------------------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LRGAAQLAQAAVHPAPPWSLITPQPQDRRFAGPEWRQPPFNLMAQSFLLAEEWWRDATTGIRGVSQQNAK
00477641   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00489651   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00474951   1/1  ----------------------------------------------------------------------
00502061   1/1  ----------------------------------------------------------------------
00457411   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00425511   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------
00464101   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00476271   1/1  ----------------------------------------------------------------------
00460041   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00457361   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00501121   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00471941   1/1  ----------------------------------------------------------------------
00473171   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00474441   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00480031   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00470341   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00490941   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00433261   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00495911   1/1  ----------------------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  ----------------------------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IVEFAMRQMLDVFAPSNFALTNPEVIRRTLTSEGGNVTAGLRNWWEDLLQTMSHDTDLKHDFEVGRDVAV
00477641   1/1  ------------------------------------------------------------------lfdp
00472001   1/1  ----------------------------------------------------------------------
00476831   1/1  -------------------------------------------------------------------dlp
00496311   1/1  -----------------------------------------------------------------maldl
00458511   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00459841   1/1  -------------------------------------------------------------------maa
00482071   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00489651   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00474951   1/1  ----------------------------------------------------------------------
00502061   1/1  ----------------------------------------------------------------------
00457411   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00425511   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------
00464101   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00476271   1/1  ----------------------------------------------------------------------
00460041   1/1  ---------------------------------------------------------------------P
00491281   1/1  ------------------------------------------------------------------alpv
00457361   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00364431   1/1  -------------------------------------------------------------------lpv
00501121   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00471941   1/1  ----------------------------------------------------------------------
00473171   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00474441   1/1  ---------------------------------------------------------------------p
00489821   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------allvpv
00475921   1/1  ----------------------------------------------------------------------
00480031   1/1  -------------------------------------llnkyllfngkslpvfdtselirevvivedvli
00486331   1/1  ----------------------------------------------------------------------
00395261   1/1  ---------------------------------------------mkllllllllallllstagpagvtv
00470031   1/1  ----------------------------------------------------------------------
00476011   1/1  -----------------------------------------------------------------lgllP
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00466391   1/1  -------------------------------------------------------------------kpP
00470341   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00490941   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00433261   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  ----------------------------------------------------------------------
00411931   1/1  -------------------------------------------------------------------vev
00495911   1/1  -------------------------------------------------------------fetkslllr
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  ----------------------------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TPGKVVYSNDLIELIQYAPATGEVRPEPILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPT
00477641   1/1  lllfdpevlldiselisklgypveevtvttedGltlplylylpptygelgggpkppvlllHGlggssesw
00472001   1/1  -------------dlellldisellkklgvpveevtvttpdGvrlhyrlylpkpppppgggpgppvlllH
00476831   1/1  pveevtvttpdGvrlhyrlylPpg..ggplPvvvllHGgggssgswrplfrslaraLaerGyrvvapDyr
00496311   1/1  l.vtvttpdGvrlayrlylPagagpkkgppvvllHGgggsseswrp.....laeaLaarGyrVvapDlrG
00458511   1/1  ------------------------lrllepllvpveertvttpdGlrlhyreygppsgppvvllHGlggs
00465731   1/1  --------lelepllnpveertvtvgdGlrlhyreagp.....gp.pvvllHGlggssesw.....rpla
00459841   1/1  lvpfeertvtvdglrlhyreygp...psgp.pvvllHGlggsseswr.....plapaLae.gyrviapDl
00482071   1/1  -------lallllllltlllpallpppgvpveevtvptpdGvrlhyrlylPag..ggklPvvvllHGggg
00490371   1/1  ------------------------lrllepllypfeeryvtvpdGlrlhyreygppsgp.pvlllHGlgg
00502451   1/1  --------asfsldldllllsysspttppelylfldllllellllplltlldpllfdlpgveveevtipt
00489651   1/1  --------------------------------------------ggaalvllHGlggsseswrplapaLa
00458861   1/1  ------------------------lllllrywrdifdwltlepllvpfeefvtvsdglrlhyreygppdg
00484601   1/1  -------fkllllllllllltlllpplppppgvpveevtvptpdGvrlhyrlygPpg..ggplPvvvllH
00510011   1/1  --------------------------dgppvvllHGlggssesw.....rplapaLaerGyrviapDlrG
00372391   1/1  ------------------yrgdgegp.pvvlvHGlggsasswlldywrslaeaLaeaGyrviavdlrghG
00474951   1/1  ------------------------mleertvttdglrlhyreagsgp.pvvllHGlggv..igsseswrp
00502061   1/1  -------------------------lPeelplvpfeertvttpdGlrlhyreagdgppvvllHGlggsse
00457411   1/1  ------------------------prfvtvdglrlhyreagdgp.pvvllHGlggsseswrp.....lae
00462211   1/1  ----------------l.ppgagsgp.pvvllHGlggsseswlllgywrplaeaLaerGyrviapDlrGh
00425511   1/1  eertvtvdgvrlayreygppdg...p.pvlllHGlggssasw.....rplapalllaagyrviapDlrGh
00530451   1/1  -------lPellslpgvtveevtvptpdgvrlplrlylPag.pggklPvvvllHGgggssgsa...swrp
00481941   1/1  ------------------gslllalllrllellkldlllellllllklellleplevefvdvdglrlhyp
00464101   1/1  ------------------Ppgggsgp.pvvllHGlggssesw.....rplaeaLaarGyrviapDlrGhG
00533481   1/1  ------------------------erypepgp.pvvllHGlggsaeswwlpsswrplaeaLaeaGyrvia
00476271   1/1  -------Ggpdglr.ayllpgp..gsgp.pvvllHGlggsaeswrp.....laraLa..gyrvvavdlrG
00460041   1/1  peterlvtvdg..lrlhyreagp..gp.pvvllHGlggssesw.....rplaeaLaarGyrviapDlrGh
00491281   1/1  evetvtvpvdgdclhl.vylPa....lPavvvllhGgggsagsaslelyrglaralaarGyivvapdyrG
00457361   1/1  --------------------------erfvtvdglrlhyreygpgdkppvvllHGlggsseswr.....p
00478791   1/1  ------------------------ypgpgsgppvvlvHGlggssrswrpgldywlgpkdslaeaLakaGy
00490871   1/1  ----------------PPyrpsgggpgp.pvvllHGgg.....gsseswrplaealaerGyrviapdlrG
00364431   1/1  etvtiptgdgrlpaylylPag.agpapvvvllhglg.....gssasfrplaralaarGyavlapdlrghg
00501121   1/1  ---------------------erfvtvdglrlhyreagp.gp.pvvllHGlggsseswr.....plaeaL
00460771   1/1  --------------------------elpfeertvtvdglrlhyleagpgdkppvvllHGlgpGpgsses
00479401   1/1  -------vgllsldldllllsysslttpsdlylfddlllaelelllltalllpelfdlpgveveevtipt
00457421   1/1  ---------------------sefvtvdglrlhyreagp.gp.pvvllHGlggssesw.....rplaeaL
00471941   1/1  --efvtvdggdllllrlhyreagdgp.pvvllHGlggssesw.....rplaeaLaerGyrviapDlrGhG
00473171   1/1  --------------------------HppvlllHGlggsaeswr.....plaealaeaGypdvrviapdl
00480751   1/1  --------------rlhyrpag..egkppvvllHGlggsseswrp.....lapaLad.gyrviapDlrGh
00474441   1/1  veegrfvtvdglrlhyreag.sg....ppvvllHGlggglgssesw.....rplapaLae.gyrviapDl
00489821   1/1  ------------------------llllllllllllllllllvlllllllkllepllnpveertvtvdgl
00473881   1/1  eevtvtvdglrlayrlygppggpklp.vvlllHGlggsseswrpla...laealaarGyrvvapdlrGhG
00475921   1/1  ------------------lll.pgsgppvvlvHGlggsarswrpggdyWpglldslaeaLaeaGyrvial
00480031   1/1  tmrdgvldrLaadiyrPkdtgklPviltyspygkdinaplldpkllsevelvtfktadGlelhgylylpa
00486331   1/1  -------lpveevtipspdgdrlplrlylPagyapggklPvvvllHGg.....ggsseswalfgrplara
00395261   1/1  etvtipsdggrlpgrlylPagadagklPvvvllhGlg.....gsaesyrglaralasrGyavvapDlrgh
00470031   1/1  -------rlpallalllllaallaslpappggtveevtipsrdgdr.plrvylPagydpggklPvvvllH
00476011   1/1  vgelRfkaPvplepwpacpqllslllpgllinkllekllrslldpepgvevedvtiptsdgrlylrlylP
00466241   1/1  -----------mkllllllllllllllllllllalllllpylpseldvrfllytlenpevrfitvdglrl
00460121   1/1  ----------------------------------------------Kklllllllilllllplgtllfrl
00480081   1/1  ---------------------------mklllllllllllllllasllqrpllllpssppeldvrlllyt
00445601   1/1  -------------------------gppvllvhGlggsssshwwrp...laealasagyrvvaldlpghg
00423391   1/1  ------------------------dgppvllvHGlggssysw.....rslaelLaaalpGyrvialdlrg
00466391   1/1  vlaagagelrfkppepwsllgvldatllgplcpqllpppgvevedvtipgsdgrlplrlylPag.pggkl
00470341   1/1  ------------------------mkillillllllllllliglllrplsrllllpalenllfllytpln
00472201   1/1  --------------mkllllllllllllllllllllllllllpllppeldlrfllytlpleevrittedg
00476001   1/1  -------gllllllalllaslpslpggtveevtvtspvdgdtlplrvylPagydpggplPvvvllHGggg
00498871   1/1  -------------------------eevrteiltldglrlyyppgggklPvvvllHGgg.....gsaesw
00493831   1/1  -------llpipalyvvelvffstvdgdklplrvylpkg....klPvvvllhGgggssgsaswspyggla
00467931   1/1  -----tvdglrlpyrlylpaggggpkplvvllHGlg.....gsgadwrplaralaeagfrvvapdyp...
00490941   1/1  ------vdglrlhyrewgppdg...p.pvvllHGlg.....gssaswrplapaLaaagyrvialDlpGhG
00480531   1/1  ----------pwsgvldllllllllllllllllllllllatkfgpacpqpvdlyppgvevedvtipspdg
00466701   1/1  -------sspggpvveesvtstvdgdrlplrvylPagag....PvvvllHGgggsagspswrnygglaea
00489451   1/1  -------dlpgvpveevtiptpdGvrlplrlylPagadpggklPvvvllHGgggssgsps...wrplara
00458241   1/1  ------------Mrlylylpp.gggplpvvvllHGgg.....gsaeswrplaealaerlpgyvvvapdyr
00410811   1/1  -------------------------peegrfvtvdglrlhyrevgppdgkptvvllHGgpggssgswrp.
00433261   1/1  --melislllgfgglqkvyslaflrllvslpsapdgldvrfllytpdnpeigqllllldplllyrpgfng
00502261   1/1  ---------------dgmsepvtitseDglylnvtltlpeispgpkPvvvflHGGgfllgggsaesfrpl
00496371   1/1  ---------distilynelellatlsdlaycvydayiylpnklncllnalkllkglelvlvfelvddkeg
00400461   1/1  ---------------------------------------gdsLlavrllarlplsllfdaptveelaall
00411931   1/1  eevtfksadgtklpgllylPpgadpggkyP.vvvllhGgggssgvpdsfsllplaqllasrGyvvvapdy
00495911   1/1  lpdgviitlvlykpedagdks....kpvvlfihGgs.....ggselpvyanlakdLvrqGydvllvdyrg
00461261   1/1  -----------------------------------------------dalaailpgagvavvgvdlryfa
00396021   1/1  --------------------------------------fvggsadlptydrlaralaaagyvvvsvdyRl
00496381   1/1  -Pislylydellllarlssaaycvydvdlplleplkcllnalplfpgfelvevllytddndtglqgyvav


                         -         *         -         -         -         -         +:350
query           AKHRDLTLEDYRRLGVMAAIETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRDGDDRLRSITLFAAQTD
00477641   1/1  ldlgperslaeaLaerGyrvvapdlrGhGgsagpyslgpapgepgdysledlavddlaaaldylrerlgi
00472001   1/1  GlggssgswldlgperglaeaLaerGyrVvapDlrGhGrStgpgflddgpgdpgdysledlaeaDlaaai
00476831   1/1  GhGgSggppysgedladDlaaaldalrenlgidervvlvGhSmGGalalalaa...ryPd.rvkglvlls
00496311   1/1  ghGrsdglppdysledl.aeDlaalldalreq.gpervvlvGhSmGGllalalaaryp......vkglvl
00458511   1/1  seswr.......apaLaaalgyrviapDlrGhGrSdgppdlgdysledlad.dlaalldal....giekv
00465731   1/1  eaLaeaGyrviapDlrGhGrSdgppspypysledlad.dlaalldal....glepvvlvGhSmGGllala
00459841   1/1  rGhGrSdgpp..pdysledlad.dlaalldal....giepvvlvGhSmGGlvalalaary....Pervkg
00482071   1/1  ssgsa..gswrplaeaLaarGkpldtdrvyrVvapDyrGhGgSdgpapeapytllgwgfsledlaeDlaa
00490371   1/1  ssesw......plapaLaeagyrviapDlrGhGrSdgppdlgdysledlaa.dlaalldal....giekv
00502451   1/1  pdGvrlpyrlylPpg.gggklPvvvllHGggg.....sseswrp.araLaarGyrvvapDyrGhGrSspp
00489651   1/1  erGyrviapDlrGhGrSdgppg.pdysledlad.dlaalldal....gidekvvlvGhSmGGlialalaa
00458861   1/1  ppvvlllHGlggssesw.....rplaeaLaarGyrviapDlrGhGrSdgppspa...dysledlad.dla
00484601   1/1  Gggfvsgvaalgsseswrplggns.araLaarGyrVvapDyrGhGeSlgpegplslgddflggfgedaad
00510011   1/1  hGrSdgppsplysledlad.dlaalldal....gidekvvlvGhSmGGlialalaary....pervkglv
00372391   1/1  rs..P.....ysledlaadlealldalgiekvvlvGHSmGGlvalyaaarrP....drvaslvllgpphl
00474951   1/1  laeaLaa.gyrviapDlrGhGlSdgppapysledlad.dlaalldal....gidgpvvlvGhSmGGllal
00502061   1/1  sw.....rplapaLadrGyrviapDlrGhGrSdgppdfpdysledlad.dlaalldal....giekvvlv
00457411   1/1  aLaerGyrviapDlrGhGrSdgppgdysledlad.dlaalldal....glepvvlvGhSmGGllvalala
00462211   1/1  GgSdgpp....ysledlae.dlaalldal....giekvvlvGhSmGGlvalalaary....pervkglvl
00425511   1/1  GrSdgppdlgapysledlaa.dlaalldal....giervvlvGhSmGGaialllaarhpe....rvaglv
00530451   1/1  laralaarGyrvvapdyrggpehGfssgppgladggdllaedlaaaldwllen.gidprvvlvGhSmGGa
00481941   1/1  ppgggsgplpvvllHGgggssgspswr.....plaraLaa.gyrviapDlrGhGeSdgppdrlgpysled
00464101   1/1  rSdgppspdysledlad.dlaalldal....gidepvvlvGhSmGGlvalalaa...rype.rvkglvll
00533481   1/1  pdlrGhGgSdgpp....ysledlae.dlaalldal....giekvvlvGhSmGGlvalelaarype....r
00476271   1/1  h.............edlaadlaalldalgpdrPvvlvGhSmGGllalalaarl.eeypervaglvllspp
00460041   1/1  GrSdgppsdysledlad.dlaalldal....giepvvlvGhSmGGlvalalaary....Pelrvkglvll
00491281   1/1  fggsgpppadgnyglldql...aaaaldwlranlgidpgrvvlvGhSlGGalallla....lryPdlvag
00457361   1/1  lapaLaeaGyrviapDlrGhGrSdgpps....dysledlad.dlaalldal....giekvvlvGhSmGGl
00478791   1/1  rVialDlr.....psdysledlae.dlaylkgGtvdywdfsfdeiglydlpaaiealldalglelkvvlv
00490871   1/1  hGgsdgpppdysledlae.dlaalldallel.gpekvvlvGhSmGGllalalaaryp......vkglvll
00364431   1/1  lsggppdpalpldlgallallaaysldalvedleaaldylraqpvdagkvglvGhSlGGalallla....
00501121   1/1  aerGyrviapDlrGhGrSdgppsdysledlad.dlaalldal....glepvvlvGhSmGGlvalalaary
00460771   1/1  w.....rplapaLae.gyrviapDlrGhGrSdgppsleysledlvd.dlaadlealldalgidkvvlvGh
00479401   1/1  pdGvrlhyrlylP..dgggklPvvvllHGgggsseswr.....plaraLaarGyrvvapdyrGhGesggp
00457421   1/1  aerGyrviapDlrGhGlSdgppsdysledlad.dlaalldal....glepvvlvGhSmGGlvalaYlaar
00471941   1/1  rSdgppgdysledlad.dlaalldal....glepvvlvGhSmGAGlvalalaar....ypervkglvlls
00473171   1/1  rghglsd......eysledlaadlealldalglekvvlvGhSmGGlvalllaarlpal..drvaglvlls
00480751   1/1  GrSdppad....ysledlad.dllalld........epvvlvGhSmGGlialalaary....pervkglv
00474441   1/1  rGhGlSdgppgpdysledlad.dllalldal....giekvvlvGhSmGGlialalaar....ypervkgl
00489821   1/1  rlhyrlygpgdgp.pvvllHGlggsseswrpltgpgpglaeaLaarGyrViapDlrGhGrStgpvsldpg
00473881   1/1  lSdgppsllpysledlaadlaalldalglervvlvGhSmGGllalllaarype....rvkglvllspald
00475921   1/1  Dl.GhGrSgadysledladdlggfwdfsfdeiakyDlpalideaialldalglegkvilvGHSmGGlval
00480031   1/1  g.gkkp.vvvllHGgp...gssdrgsfrplaqylaarGyavvavdyrGsggsggpfdnygpde..veDll
00486331   1/1  laaraGyavvapdyrGhgesggppadagsgnlglldledlaaaldalldalgidpervvlvGhSmGGala
00395261   1/1  gespgpp......vedllaaldyllallearlgvDpdriglvGhSmGGalalllaard....pd.vkavv
00470031   1/1  GgggssgsalssldswrplaealaarGdlppyrvvap.............pgpygledlaaaldwlldel
00476011   1/1  ....ggplPvvvllHGGgflggsadswrp.....laralaarlGyavvapdyrghgesggp.....aale
00466241   1/1  ..yyppsgdgkkpvvvllHGgg.....gsaespywrplaeaLakrGgyrvvapDyrGhGespgpaalydl
00460121   1/1  plllppppddldvrfllylnlnpeevtfvdvdglrlyypppgdgkkpvvvllHGgggssgspywrplara
00480081   1/1  peniesrdgdtlglrlyypesgdgpkpvvvllHGgg.....gsaespywrplaraLadrGdyrvvapDyr
00445601   1/1  ls.........slddwvedllalldalg.epvvlvGhSlGglvalrlaarlpela..rvaglvllapalp
00423391   1/1  hGlsdkp...geysledlaadleallealg.ekvhlvGhSmGGlvaralaarlp....erkvkslvllap
00466391   1/1  PvvvflHGGgflggsaeswrp.....laralaarlGyavvapdyrghgesgg......pagledlaaald
00470341   1/1  peevrfvtvdgllrlhyylpgksgpvvvllHGgg.....gssespywrplaeaLakrGdyrvvapDyrGr
00472201   1/1  lrlhyrppgdgkgp.vvvllHGgg.....gsaespywrplaraLaerGgyrvvapDyrGhGesdgppg..
00476001   1/1  ssgswsl..yrplaralaarliglgklpgyvvvapdyrGhgesggp.aagndgeddaedllalldalirf
00498871   1/1  rplaealaerGyrvvapdyrghgesdgppddysledla.edllaaldwlreniavfggllllldpl.rvv
00493831   1/1  ealaergyivvapdyrgggegflwpsssgppgnfgledlldalaedlidlleaklgidpervalvGhSmG
00467931   1/1  ..ghgespnpgaggrawfdilalspggpedeagledaaedlaalidallrlgidperivlvGfSmGGala
00490941   1/1  rSdgpp.dysledlae.dlaalldalla..glepvvlvGhSmGGlvalllaarlgla.pervaglvllsp
00480531   1/1  dprlplrlylPag.pggklPvvvflHGGgflggsaesw.....rplaralaarlGyavvapdyrghgesg
00466701   1/1  laerGyivvapdyRgggflrghgdsdgppgnfglldiedaladelidalidalgidpervalvGhSmGGl
00489451   1/1  laarlGyavvapdyrGhGesggpptpagaaysgedlaeDlaaaldwlrenfgidpdrvvlvGhSmGGala
00458241   1/1  ggplgflgglqlfdllrghgespgpagllysledlaadllalldalaelgldpdriglvGhSmGGalala
00410811   1/1  ....lipaLae.gyrviapDlrGhGrSdpp.pgegytlddladdlealldallglekvvlvGhSmGGala
00433261   1/1  drpvvvllHGlggsags...swwlplaralaarlgynvvavDyrghgrspypaaaydledlaadlaalld
00502261   1/1  aralaarG.llnvvvlvapdyrghgespgpag...ledlaaaldwlldnldpdrivlvGhSaGGalalal
00496371   1/1  glqgyvavdddkktiviafhGt............ssladwltdlgfrvvavdlrgh.gkshrgflrs---
00400461   1/1  dsrlveadglrllvylpgggagpplvllHGggaggsaasyrplaraLaa.gyrvvavdlpgygas.eppp
00411931   1/1  rGsggsggafrdagpgnlgpadveDliaaldylralggvdpdriallGhSyGGylalalaary....pdl
00495911   1/1  sgesdvplsledlae.....lleylvkligpskivliGhSlGGllallfalllprs.nslvkgvvligpi
00461261   1/1  rvfggvafldslaegaddlaalldallakcpdtkivlgGySqGaavaalaalelpedladrvagvv----
00396021   1/1  aglsfpehpfpaaleD.....avaalrwlreniaafggdrvvlaGdSaGGnlalalalrlrdrglpprva
00496381   1/1  dddnkpiviaihGtgsladwltdllllaegynviavdlrghggslgay.....dyvledladlike----


                         -         -         -         -         *         -         -:420
query           FTEAGELTLFINESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWN
00477641   1/1  ekvvlvGhSmGGllalaaaarlpelge.rvkglvllappldlsplaepllrlllalllfldgllgllgll
00472001   1/1  dylldalgiekvvlvGhSmGGllalalaaryPelgd.rvkglvllsppldlsdlaepllallaallllla
00476831   1/1  paldl..........llddlllpggapllplllalllgdlaalllallrllleallrllaallllsplla
00496311   1/1  lsppldlsalalallrllllll................................................
00458511   1/1  vlvGhSmGGllalalaar....yPervkglvllspplplsaladallllarqallpdllaallallpagl
00465731   1/1  laary....Pervkglvllspplplsapldallealakllaslpdllfllggllelllplspaallrlla
00459841   1/1  lvllspplplsaladaalllllllaallarllellgalspeellellarllladlldpelleaylrllla
00482071   1/1  aldwlrenfgidpervvlvGhSmGGalalalaary....Pdrvkglvllspald................
00490371   1/1  vlvGhSmGGlialalaary....Pervkglvllapalplseladwllrllakallepllllllalllall
00502451   1/1  aslngalgfasggdfpaatlgdlggvenallrllaeDlaaaldwlrenfgidpervvlvGhSmGGalala
00489651   1/1  ry....pervkglvllapppplsalalallll........................lllelllalllall
00458861   1/1  alldal....giepvvlvGhSmGGllalalaary....Pervkglvllspplplsalapallrllaa...
00484601   1/1  DlaaaldwlrenlgidpervvlvGhSmGGalalalaarl..yPd..vkglvllspaldl...........
00510011   1/1  llapppplsaladallrllllalllllllllllyllllllllgglallltdpellalllalllagfaral
00372391   1/1  gspladllprl......lpllllealllalagllgallslllgpelllqilldalsdlttellaaflell
00474951   1/1  alaar....ypervkglvllspplplsala..........................plllalllllllle
00502061   1/1  GhSmGGlialalaary....Pervkglvllapapplsaladallrllaalllalpallfglgallellla
00457411   1/1  ary....pervkglvllapplplsalalallllllaallalllalllallallaeallaalfgpllrddl
00462211   1/1  lap...pldgsaladallellaaallallatllgallallllllllllldpelleallelllrpgplraa
00425511   1/1  llapaapleala..pallrllalllarlllptleallallallaallpllpeallrallrrllaldflgl
00530451   1/1  lalalal....rypdrvkalvllspaldlaallpsllelllllllllllll...................
00481941   1/1  laad....llallrdalgidpvvlvGhSmGGllalalaarlaarypervkglvllsppldlse.......
00464101   1/1  spplplllaslaalllalla.allsllllllllallllllgllpallspeellayllallrpgflaaala
00533481   1/1  vkglvllappldgspladallellrkallalllkllgllpe.............................
00476271   1/1  lplsalalal............................................................
00460041   1/1  sppadlsaladall..............................pllllallldlllallaallaaller
00491281   1/1  lvllsgplpgsaaala......................................................
00457361   1/1  ialalaaryl...pervkglvllappl...........................plllglppllglllar
00478791   1/1  GHSmGGlvalaaaarlgpelveklivvdiapvlydgrlawypervkglvllapPhlGspladlll.....
00490871   1/1  spaldlsa....................................lpllleallkrlldrllgdel.....
00364431   1/1  ..apdrvkalvllagaldl...................................................
00501121   1/1  ...gpervkglvllspplplllladallagllrallaallalllaplllalrrllgllpallslpellea
00460771   1/1  SmGGlialalaary....pervkglvllspalpl....................................
00479401   1/1  padysledlgfyddeqakpyglhfpmvadDlaaaldwlrenfgidpervvlvGhSmGGalalala..ryp
00457421   1/1  y....pervkglvllsppap...........ladladplaglllarllaallalllallpelllrlllel
00471941   1/1  ppapl..lllaellplgllaallarllalllaglpelllrllallflpplllleelldellaalllpf..
00473171   1/1  ppl...................................................................
00480751   1/1  llapapplldlaellarllkalaallalllllleallkrlllllllglllddelaelllallralg..ta
00474441   1/1  vllapalplsa..........................llplllalllallpeallarllrllgadpllls
00489821   1/1  tgkgyyvdatlplllllglglewsllrfdgppgdggaglvysledlae.dlaalltdalrartgvlllla
00473881   1/1  llal..................................................................
00475921   1/1  yaaarl.peegpeeiealgsggpklspllksypdrvkglvllapPhlGspladllrsllplllllpllae
00480031   1/1  avidwlvkrggaftgrtggkeakqpwdngkvgllGhSyGGylalllaar....ypdrlkalvllagvsdl
00486331   1/1  lala....lrypdrvkalvllspaldltalala.....................................
00395261   1/1  llapvldl..............................................................
00470031   1/1  lginiaafgtlaerlllklgdpervdrvlvGhSmGGalalalalry....Pdrvkalvllspald.....
00476011   1/1  dlaaaldwllenldalgidpdrvvlvGhSaGGalalalalrypdrglprvaalvllspaldll.......
00466241   1/1  edaae.dlaalidallekygidperivlvGhSmGGalalalaary...----------------------
00460121   1/1  LaerGgyrvvapDyrGhGesdgppady....sledla.edlaalldal----------------------
00480081   1/1  GhGesdgpaglydledaaedlaalidallekygidperivlvGhSmGG----------------------
00445601   1/1  lle...................................................................
00423391   1/1  Phlgspladllpllllpdlllkl...............................................
00466391   1/1  wllenlaalgidpdrivlvGhSaGGalalalalrypdrglprvaalvllspvldlpa.............
00470341   1/1  Sdgpapdd..eysledl.aedlaalldallenfgidperivlvGh-------------------------
00472201   1/1  ..lydledaae.dlaalidallekygidperivlvGhSmGGalal-------------------------
00476001   1/1  ggdpdrvalvGhSmGGalalalal...rypd.rvkalvllspaldllalalallllal............
00498871   1/1  lvGhSmGGalalalal...rypd..vkalvllspaldllalllalllllll...................
00493831   1/1  Gllalala....lrypdlfkgvillspaldlsdlals.........ellelllkelgekgvprllgnvyl
00467931   1/1  lllalrlpd....rvaglvllsgalplaallp......................................
00490941   1/1  applaalaa.................lllrlllllpllealla.lllaallrrllallflad.ldpella
00480531   1/1  g.....paaledlaaaldwllenldalgidpdrvvlvGhSaGGalalalalrypdrglplvaalvllspv
00466701   1/1  lalalalr....yPdlfkalvllspaldl.........................................
00489451   1/1  lalalry....pdrvkalvllspaldllalllsllllll...............................
00458241   1/1  laslrypd...rfkalvllspaldlldlllsllllll.................................
00410811   1/1  layAaryPd....rvkglvllgpagllplellalllllllllpallaallaallallladllaalllrll
00433261   1/1  alianygidpervhlvGhSlGghvAllaalrl....p.rvaglvlldpagplfeltdplrrldpsdadfv
00502261   1/1  alrypdrglplllllldllsllsrvkalvlispvldllalllslll........................
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  ysledl....aadlaallralqgdgpvvlvGhSlGGllAlalalrlrdrger.vaglvlldpplpldpea
00411931   1/1  fkaavalspvldl.........................................................
00495911   1/1  ldgviplaayl-----------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  glvlispvldl.......paalpselenlarrla....................................
00496381   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ADATRMPYRMHSEYLRKLFLDNDLAEGRYTVDDRAIALSDIHTPMFVVGTLRDHVAPWRSTFKIHLLADA
00477641   1/1  pgellagalrllrpddlsleelvakllrlllggdapafdllaldadltglpagtsldellhllqlfdend
00472001   1/1  allgllgalllallarallalllgdlllealvaellalllgldpalldllaldallaalparlllellrk
00476831   1/1  dlsylrllalrllaafd.nfllalllalrllddyyregdpledlakikvPvliihGedDplvpesaeala
00496311   1/1  ....lppefledllalfdeelrdlllgllrallalaeadpledlakikvPvliihGedDplvppedaeal
00458511   1/1  laalleallrllallaflsdealleallrllalylalltdpeallallealraglflrldygyllndlly
00465731   1/1  dlplglaallaekfgrwlgfdveslldnqgsallddelldallrlllrpdfraalrllrallllaradll
00459841   1/1  dgalraalalyrlllealdlsdl.............alaradllealakikvPvlvihGedDplvppeaa
00482071   1/1  .......................llpldpallerlllallgdllaallallalllddlpealaallagll
00490371   1/1  lallleallellladlllsddlaalllllllllsdlrlspeallalldalsalslaraplngyrnalfyy
00502451   1/1  la...arypd..vkalvllspaldls............................................
00489651   1/1  lallllllgadpslldeeelrallaallrpgdaeallallralrlalallaradllealkkikvPvlvih
00458861   1/1  ..........lllalllalllallrelllrlllllaallaglspelleallalllapg.alradlallra
00484601   1/1  ............................lpadlpsleralldallddllpllllrllladaallppelld
00510011   1/1  lallagllda......................lallaeadllealkkikvPvlvihGedDplvppeaaee
00372391   1/1  pgsgflaallhgaqlvpgvrygsylrllllnlel........dpladlrkikvPvllihgenDglvppes
00474951   1/1  llarllallgadpalldpelleallalllrpgalralaaly......ralldaleradllealakikvPv
00502061   1/1  l..dplallralldllygddalllekfgrwlllenafsvelypaplsdelleallapllrpgfrallrfl
00457411   1/1  lldellellrdlllradlaallallralarld.........................llealakikvPvl
00462211   1/1  lllyraldd........................llaeadllealkkipkkvPvliihGeddplllsslll
00425511   1/1  lfdpallaallealarpgaraslealrallralaladl.......raalaritvPtLvihGedDpvvppe
00530451   1/1  .....................................................laallaldplellakik
00481941   1/1  .........................................................llesllrlllarl
00464101   1/1  llrglldalallaradlle......................alakikvPvlvihGedDplvppeaaeela
00533481   1/1  .................................lllllallrrldllealkkikvlttegallfnakyPn
00476271   1/1  .......rlppgllaallellraldllplelllaglllklllldllywnldalakikvPvlvihgedDpl
00460041   1/1  llallgldpllldeelleallalllapggldallaylrallalaldllealakikvPvlvihGedDplvp
00491281   1/1  ..........elpeallallggldlelllg.pvllgdlllldpldlledlkaikvpvliihGedDpvvp-
00457361   1/1  llalllallgallaellrrlllslllplllsdelleelllallrdlllradlegllallralrradllea
00478791   1/1  ..........................allpllallllaallsfllrll.allsflpdldldl--------
00490871   1/1  ........ldlllladplllarllldlladllalle.dllealakikvPvliihGedDplvppedaeela
00364431   1/1  ..................................................dpledlakikvPvliihGed
00501121   1/1  lleylrddllradlrallallralrd.........................adllealakikvPvlvihG
00460771   1/1  ...ppllplllarllalllallleallelllrlllspdpltldpelleallrlllapgalaalaallrll
00479401   1/1  dr...vkglvllspaldlaa..........................................lllpeall
00457421   1/1  llpllladaelleallrylldlllradlrallallralarad...........llealakikvPvlvihG
00471941   1/1  .......lraglrallralrallldlldllerlkaid.........vPvlvihGedDplvppealaeela
00473171   1/1  ..............................lllllldllellakikvPvlvihgedDpvvppesa....l
00480751   1/1  dllallellralrra........................dllealkkikvPvlvihGedDplvppeaaee
00474441   1/1  delleaylrpllrpdflrallalllalasaldlyd....adllealkkikvPvlvihGedDplvppeaae
00489821   1/1  naeslgiglervvlvGhSmGGavalllaaryPe....rvkglvllspald....................
00473881   1/1  ..................................lealakikvPvlvihgedDplvppel.alaealpna
00475921   1/1  llrsllglllllllldfdlallpllllslll............fldllrdfra...........------
00480031   1/1  yrdyrehggillpgglpgedldv...........................laaalysrlllpgdllklee
00486331   1/1  .......................lllleaglgllpellealraydplell..............akikav
00395261   1/1  ..........................................edlakikvPtlvihgeaDpvvppeqaea
00470031   1/1  ......................................................................
00476011   1/1  ....................................................alapslaellggdpllpp
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00445601   1/1  ......glpellellkrldllel..............lkklpvpvlvihgedDpvvpfelaerlaeal..
00423391   1/1  .....llllllteflqklvpagysrdpllvdlylessifladlnnerallanleykenlsrlvpvllihg
00466391   1/1  ............................................sldlpslreladgpllppallerllg
00470341   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00476001   1/1  ......................................................................
00498871   1/1  ..............................................................lalllayd
00493831   1/1  eylraydpl..........................................................dll
00467931   1/1  ..........................................................dllellaklkvP
00490941   1/1  alladllrlgaaalaallral........dllaradllaalakikvPvlvihGedDplvppe.....erl
00480531   1/1  ldl...................................................................
00466701   1/1  ...............................ladllpflerllkallgekglpaylgpivpeallayspl
00489451   1/1  .........................lleallgllpellealraysplellkl.........lllakikvP
00458241   1/1  .................................................................kvPvl
00410811   1/1  fpdallrdpelvae..............lledllrasglaaalalllllyllllaalarldllerlakik
00433261   1/1  dvihtdaglllpllglglleplghadfypnggvsqpg............................-----
00502261   1/1  ..........................................lrkflleylggdlaedlelllaaspl.l
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  lslld.....................................................eellaallrlgg
00411931   1/1  ...................llydtayterylglpllpedpealkayspleladkikpppvllihG-----
00495911   1/1  ----------------------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  ........alaggplltlealarllrlylpdgadlddplaspllalddllrglpPtlivhgeaDplvp.e
00496381   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EITFCLTGGGHNAGIVSPPSPKAHGYQVMMKEADGPYIGPDDWIKEAPHAEGSWWTEWVHWLEARSGQPV
00477641   1/1  lltydrglgygdlaeyyqrasp------------------------------------------------
00472001   1/1  ll..dlfdengllllgrgldyr------------------------------------------------
00476831   1/1  allpgapvllvipgggHg----------------------------------------------------
00496311   1/1  aealpaaga.elvvipga----------------------------------------------------
00458511   1/1  g.......sradll--------------------------------------------------------
00465731   1/1  ealakikvPvlvih--------------------------------------------------------
00459841   1/1  eelaellpnaelvvipgag---------------------------------------------------
00482071   1/1  allllralaaal----------------------------------------------------------
00490371   1/1  eradllealkkikkv-------------------------------------------------------
00502451   1/1  ....................rlllgllpalllrllaellglllpdpeelldalraysple----------
00489651   1/1  GedDplvppeaaeelaell---------------------------------------------------
00458861   1/1  llgfldldd.yyr---------------------------------------------------------
00484601   1/1  allaslllldslaallrf----------------------------------------------------
00510011   1/1  laellpnaelvvipgagHf---------------------------------------------------
00372391   1/1  arlgfvlrlakllpgael----------------------------------------------------
00474951   1/1  lvihGedDplvppedaeal---------------------------------------------------
00502061   1/1  rallargdllealarrkik---------------------------------------------------
00457411   1/1  vihGedDplvp-----------------------------------------------------------
00462211   1/1  sgpdkdpvlvygdganlldlllllllal------------------------------------------
00425511   1/1  aaralaellpna----------------------------------------------------------
00530451   1/1  vPvliihGedD-----------------------------------------------------------
00481941   1/1  llddlleallgglla-------------------------------------------------------
00464101   1/1  ealpnaelvvipgagHflf---------------------------------------------------
00533481   1/1  ggleapgsaeeglplell----------------------------------------------------
00476271   1/1  vp.eaaealaealpgpve----------------------------------------------------
00460041   1/1  peasaealaealpnaelvv---------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00457361   1/1  lkkikvPvliihGedDpvv---------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00490871   1/1  ealpgadvelvvipgagH----------------------------------------------------
00364431   1/1  DplvppelaealaealkagpdvellvypgagHgffleeagly......................------
00501121   1/1  edDplvppealaeelaeal---------------------------------------------------
00460771   1/1  lsaldlyadllealkkikv---------------------------------------------------
00479401   1/1  allrallldeflraglpt----------------------------------------------------
00457421   1/1  edDplvppeaaealaealk---------------------------------------------------
00471941   1/1  ealpnaelvvip----------------------------------------------------------
00473171   1/1  lpnae.lvvlpga---------------------------------------------------------
00480751   1/1  laellpnaelvv----------------------------------------------------------
00474441   1/1  elaellpnaelvvipgagH---------------------------------------------------
00489821   1/1  .................-----------------------------------------------------
00473881   1/1  e.lvvlpgagHfl---------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00480031   1/1  ayekllaellparyrahplyddfwrdr....splenldkikvP---------------------------
00486331   1/1  PvliihGedDp-----------------------------------------------------------
00395261   1/1  laealpaagvpael--------------------------------------------------------
00470031   1/1  ............glglll----------------------------------------------------
00476011   1/1  ellerlrallledlaall----------------------------------------------------
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00445601   1/1  gaelvvipgggHllllegpeevaellldfldflek-----------------------------------
00423391   1/1  enDgvvppess-----------------------------------------------------------
00466391   1/1  allgdpad....lldplasplealdkikvPpvliihGed-------------------------------
00470341   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00476001   1/1  ............lakikv----------------------------------------------------
00498871   1/1  plellkkiakvPv---------------------------------------------------------
00493831   1/1  kklakikppvliihGekD----------------------------------------------------
00467931   1/1  vllihGeaDpvvp---------------------------------------------------------
00490941   1/1  pnae.lvvipg-----------------------------------------------------------
00480531   1/1  .........eellpsyle.llggppldpelleafldlllgelalralldlldplasplealdki------
00466701   1/1  ellkkliankppvllihG----------------------------------------------------
00489451   1/1  pvliihGedDplvppeeae---------------------------------------------------
00458241   1/1  iihGekDplvpp----------------------------------------------------------
00410811   1/1  vPtLiihGedDpv---------------------------------------------------------
00433261   1/1  ----------------------------------------------------------------------
00502261   1/1  aedlkkikvPvlii--------------------------------------------------------
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  lpp...lrlllpalra------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00495911   1/1  ----------------------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  alalaaalraagvpvelvv---------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PPPRIGLPDTNAAELPDAPGHYVLQA--------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00489651   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00474951   1/1  ----------------------------------------------------------------------
00502061   1/1  ----------------------------------------------------------------------
00457411   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00425511   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------
00464101   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00476271   1/1  ----------------------------------------------------------------------
00460041   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00457361   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00501121   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00471941   1/1  ----------------------------------------------------------------------
00473171   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00474441   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00480031   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00470341   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00490941   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00433261   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00496371   1/1  ----------------------------------------------------------------------
00400461   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00495911   1/1  ----------------------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00396021   1/1  ----------------------------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------