[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38720.1


[Show Plain Result]

## Summary of Sequence Search
   1::180
   1::136  1.1e-33 38.0% 0051635 00516351 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137  9.4e-29 31.5% 0051634 00516341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::139  5.2e-28 31.0% 0047894 00478941 1/1   alase/Bleomycin resistance protein/Dihy 
   1::159  9.1e-26 30.2% 0048208 00482081 1/1   alase/Bleomycin resistance protein/Dihy 
   1::139  1.4e-25 34.4% 0048209 00482091 1/1   alase/Bleomycin resistance protein/Dihy 
   1::143  2.8e-25 31.5% 0049725 00497251 1/1   alase/Bleomycin resistance protein/Dihy 
   1::136  3.3e-25 31.7% 0047985 00479851 1/1   alase/Bleomycin resistance protein/Dihy 
   3::134  4.4e-25 33.9% 0048015 00480151 1/1   alase/Bleomycin resistance protein/Dihy 
   1::139  4.7e-25 30.8% 0048855 00488551 1/1   alase/Bleomycin resistance protein/Dihy 
   1::140  9.2e-25 31.4% 0046683 00466831 1/1   alase/Bleomycin resistance protein/Dihy 
   1::133    3e-24 31.8% 0049435 00494351 1/1   alase/Bleomycin resistance protein/Dihy 
   1::144  3.1e-24 30.8% 0048964 00489641 1/1   alase/Bleomycin resistance protein/Dihy 
   2::161  3.3e-23 23.6% 0048412 00484121 1/1   alase/Bleomycin resistance protein/Dihy 
   4::139  3.5e-23 31.1% 0046737 00467371 1/1   alase/Bleomycin resistance protein/Dihy 
   1::153  6.7e-23 31.3% 0046682 00466821 1/1   alase/Bleomycin resistance protein/Dihy 
   3::136  2.6e-22 29.4% 0051145 00511451 1/1   alase/Bleomycin resistance protein/Dihy 
   1::139  8.5e-22 29.0% 0047830 00478301 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137    1e-21 32.1% 0046043 00460431 1/1   alase/Bleomycin resistance protein/Dihy 
   2::137  1.3e-21 32.7% 0047893 00478931 1/1   alase/Bleomycin resistance protein/Dihy 
   1::144  1.6e-21 27.6% 0049443 00494431 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137    2e-21 28.8% 0049535 00495351 1/1   alase/Bleomycin resistance protein/Dihy 
   3::137  5.1e-21 32.1% 0047984 00479841 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137  6.4e-21 28.3% 0049803 00498031 1/1   alase/Bleomycin resistance protein/Dihy 
   1::139  6.6e-21 26.0% 0049434 00494341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::138  7.3e-21 33.9% 0049036 00490361 1/1   alase/Bleomycin resistance protein/Dihy 
   2::148  1.1e-20 29.9% 0047558 00475581 1/1   alase/Bleomycin resistance protein/Dihy 
   1::134    3e-20 28.0% 0049436 00494361 1/1   alase/Bleomycin resistance protein/Dihy 
   4::136  5.2e-20 31.9% 0052095 00520951 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137  1.7e-19 26.7% 0049133 00491331 1/1   alase/Bleomycin resistance protein/Dihy 
   1::136  4.4e-19 31.2% 0051065 00510651 1/1   alase/Bleomycin resistance protein/Dihy 
   1::134  6.1e-19 22.8% 0049534 00495341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::136    2e-18 31.6% 0046684 00466841 1/1   alase/Bleomycin resistance protein/Dihy 
   1::138  1.1e-17 26.2% 0049683 00496831 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137  1.2e-17 28.0% 0049444 00494441 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137  1.8e-16 27.1% 0043737 00437371 1/1   alase/Bleomycin resistance protein/Dihy 
   1::134  8.3e-16 26.0% 0036022 00360221 1/1   alase/Bleomycin resistance protein/Dihy 
   4::139  3.4e-14 25.9% 0046521 00465211 1/1   alase/Bleomycin resistance protein/Dihy 
   4::138  8.3e-13 23.0% 0053079 00530791 1/1   alase/Bleomycin resistance protein/Dihy 
   1::137  1.1e-12 16.0% 0044219 00442191 1/1   alase/Bleomycin resistance protein/Dihy 
   1::132  4.6e-06 22.7% 0046159 00461591 1/1   alase/Bleomycin resistance protein/Dihy 
   1::180


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
00516351   1/1  lplllalmmitglghvtlrVsdleealaFYtdvLGlelvkrtdn............yhlflgaggghhgl
00516341   1/1  MtgilgldhvalrvsDleaalaFYtdvLGfelv..........drvpdlddggvtlaflglggggiglal
00478941   1/1  msgppmgimgldhvvlrvsDleaalaFYtdvLGfelvdrfvle....glddggvrlaflrlg.gghlela
00482081   1/1  mmmgitglghvvlrvsDleaalaFYtdvLGfelvdr.gddgv...........aflrlgdgglvlalvlp
00482091   1/1  MgitgldhvvlrvsDleaalaFYtdvLGfelvertddpd.......ggvtyaflrlggggielalfegp.
00497251   1/1  kmmsvmglmgi.hvalrvsDleaalaFYtdvLGfelvdrfddp........dgfgyaflrlggggivlal
00479851   1/1  rvslrvmgilglghvvlrvpDldkalaFYtdvLGfelvdrvddlllpg....ggfrlaflrlggdhhsla
00480151   1/1  --mitgldHvvlrVsDleaslaFYrdvLGfrlvertd.............glaflrlggghlllllllle
00488551   1/1  mm.imgldhvvlpvpDleaalaFYtd.LGfevve..........rfpdpdggvyyaflrl.ggahlelal
00466831   1/1  Gm.imgldhvvlpvsDleaalaFYtd.LGfelvertpdpd.......ggvtyaflrlg.gthlelalap.
00494351   1/1  manpmgllgidHvalaVpDleaalaFYtdvLGfelvayfdskdve.tpeggfrsaflrlpgggirleLte
00489641   1/1  nglllellldlllpasepmmilgidhvalpvsDleaaaaFYtdvLGfelver........vdfpdggfrl
00484121   1/1  -milgldhvvlpvsDleaalaFYtdvLGfelvdrgdd.............yaflrlgg.thlelalapgp
00467371   1/1  ---mgldhvvlrvsDleaalaFYtdvLGfelverfdled.......ggvgyaflrlgggahglvlelfep
00466821   1/1  lplpaspvpapmgimglghvvlrvsDleaalaFYtdvLGfelvdr.............gggyaflrlgdg
00511451   1/1  --gmmltkigrmlhvgvldved...alaFYtdvLGfelvrrfdfpdappgglaggvtlaflglg.gstla
00478301   1/1  M...gldhvalpvsDleaalaFYtd.LGfelvdrtddgg...........yaflrlgggavlelllppdg
00460431   1/1  vmmilgldhvalpvsDleaalaFYtdvLGfelvdrgdd.............yaflrl.ggtvlelalapg
00478931   1/1  -pimglghvvlrvsDleaalaFYtdvLGfelvdrdd.............gyaflrlggg.hlelalvpgp
00494431   1/1  gplpnpmgllgidhvalavsDleaalaFYtdvLGfelvarvdle.......dggfglaflalgdggirle
00495351   1/1  pmgllgidhvvlalavgdldaalafYtdvLGfelvarfrdldveg..peggfrsaflrlpdggirleLte
00479841   1/1  --SimglghvalrvsDleaalaFYtdvLGfelvdrtd.............glaflrlgggglelalt...
00498031   1/1  ll...iihvaLrvdgdleealaFYtdvLGfell......rrldfpeagaftlvflglgggvlhaeltlgg
00494341   1/1  kvdslpnpmgllgidhvalavpdleaalafYtdvLGfelva.....rvdledggrslaslalrsgdgrle
00490361   1/1  M.ikilglhvalpvsDleaalaFYtdvLGfelvergdd.............yaflrl.ggavlelalapg
00475581   1/1  -mkpmilgldhvalavsDleaalaFYtdvLGfelvarvdledg.......gvrlaflglavlaglgg.ir
00494361   1/1  mslpalpnpmgilgldhvglavpDleaalafYtdvLGfelvarve......ledggtslaflglglgdir
00520951   1/1  ---pmgldhvvlrvsDleaalaFYtdvLGfelvervdd........pdggvgyaflrlgggadghvlelt
00491331   1/1  M.ilgldhvvlavsdleaaaafytdvLGfelv........ervddetggtalsaflrlggtrlelllped
00510651   1/1  m..mglghvvlrvsdleaalaFYtdvLGfelvdrdd.............glaflrlgdgglvlalv....
00495341   1/1  nplgllgldhvvlavgdleaaaafYtdvlGfelvarhdsed.......gkvalavlllrqggivlelnep
00466841   1/1  vlprpllpmmgilrlghvvlrvsDlekaraFYtdvLGlevvdr.deg............lvflrlggggd
00496831   1/1  Mkm.kllhiaLrvdgdleealaFYtdvLgfelvrrvpdpggaf...........lglgggvllalltlgg
00494441   1/1  lsgiflpgfellllelpdpmgllgidHvaiavplgdldaalafYtdvLGfelvarvdfpd..leggyrgv
00437371   1/1  MknpvmllrldhvalavsdleraiaFYed.LGfevvaredddgeltllllglpgggvrvaflrlgggeir
00360221   1/1  mgltgidhveiavpagdleaaldfYedvlGfelvar....hdietggfglaslvllsrqgdirlelnepl
00465211   1/1  ---mkllhvvlpvkdleaslaFY.elLGfevvfrfdd.............yaflrlgglvlelleapg..
00530791   1/1  ---MklihvalavsdleaaiaFYedvlgfevlre.lgg............yaelrlggatlalvlakd..
00442191   1/1  mmmmkitpylvfngadaeeAlaFYksvfgasevlrltrygdapegpagkvmhaeltlggqllmaldagpe
00461591   1/1  lpnplgllgidhvefavgdadaaaafye.alGfelva...........ghrsvasallrqgdirlvlnle


                         -         -         *         -         -         -         -:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTAT
00516351   1/1  alfewpgapap...rpgtgglhHlafrvddredldaalerlkaaGvpvlgpvdhgggrsiyfrDPd----
00516341   1/1  tlppgpeappaalgggglhhlafevddldaldallarlkaaGvevlepgdrpggrsayfrDPdGnli---
00478941   1/1  lapg........pgggglhhlafevddldaldaalarlkaaGvevlgpprdgpgggrsayfrDPdGnlr-
00482081   1/1  ........pagggglhhlafevpsrddldaavarlkaaGvevlrepgdrpygsgrsayfrDPdGnlielv
00482091   1/1  .........gggglhhlafevddldaldaavarlraaGvevlgepgdhpggggrsayfrDPdGnlielv-
00497251   1/1  teapdgapaaa....gpglhhlafevddreeldaavarlkaaGvevvgepgdpgggrsayfrDPdGnlie
00479851   1/1  lvpgpep.........gglhhlafevddlddldaaadrleaaGvevlgpprhgpgggrsvyfrDPd----
00480151   1/1  apg.......ggglghlafsvdd...ldaalarlraagvevlegpvdrgggrslyfrDPdGnli------
00488551   1/1  ap.........agggglhhlafevdsredldaalarlkaaGvpaevlgepgdhgpgggrsayfrDPdGn-
00466831   1/1  .gpep.......glhhlafevdsredldaavarlkaaGvrlevlrgpgdhpggggrsayfrDPdGnliel
00494351   1/1  plgteddpsqiaeflekhlgpGvqhiafrvdDida...averlraagllgGvevlgeprdeyy-------
00489641   1/1  aflrlgggvhdpldlllivalalsggtvlelteapgpeppsqilaplgnlggvglhhlafevdDldaa..
00484121   1/1  dppdag...ggglhhlafevds.edldaavarlkaaGvevlee.ppgggrsayfrDPdGnlielv.egsl
00467371   1/1  pdgapappgpg.lhhlafevddldaa...varlkaaGvevleepgdhpgggvrsayfrDPdGnlielve-
00466821   1/1  gavlelalppgpep.........glhhlafevpsrddldaavarlkaaGvevlrgpgdhpyGvgrsayfr
00511451   1/1  lleapdggpapagnp.gvglvhlafevddvdaava...rlkaaGgvevlgppgdrpggrrayfrDP----
00478301   1/1  espiakflpagggglvhlafevdsrddldaavarlkaaGvevlgepgdrpgggrsayfrDPdGnlielv-
00460431   1/1  pepp........glvhlafevddldaa...larlkalglellalaGvevlgepgdrpggrsayfrDP---
00478931   1/1  .........ggglvhlafevpsrddldaalarlkaaGvevlggpgdrpggrrvlysayfrDPdGnli---
00494431   1/1  lteplgepdspaaefldkhgpgvhhlafrvdDvdaav...arlraaGveilgepvryydepgglrsayfr
00495351   1/1  plgpdgrspiaeflekhlgpgvqhiafrvdDida...avarlkaaGvevleePrtyydglgvrfayf---
00479841   1/1  .......papgpglhhlafevdsrddldaalarlkaaGvevlgepgdrpggrrvfysayfrDPdGnl---
00498031   1/1  tllllldagpeeppeagggvhlafsvddvdevda.yarllaaGgevlmpptdtpwggrfayfrDpdG---
00494341   1/1  lteplnpdaagvlelllnlgtspiaeflekhgpgvqhiafrvdDidaa...verlraaGveflseprdg-
00490361   1/1  pepaaa........vhlafevddldavlarldrllaaGvtiliepgvrepgdhpggrsayfrDPdGnl--
00475581   1/1  lelleppgpespiaefldkhggpvglhhiafrvddvdaa...varlkaaGvevlgepgdrpggggevrsa
00494361   1/1  lellappdpgpvlelthnlgvesldlldlspaaaflerhgpglahiafrVddlda...avarle------
00520951   1/1  eppdpapp...phgtg.lhhlafevddldaa...varlkaaGvevleep..gggrsayfrDPdGnl----
00491331   1/1  pepp.......gvhhiafrvdd.edldaaverlkaaGvevlgepiregdggrvfyfrdpdgnlielv---
00510651   1/1  ....ppapagggglvhlafevpsrddldaalarllaaGvtvleep.pgggrsayfrDPdGnlielv----
00495341   1/1  lgedgpaasqiaeflaah.gpgvqhialrvdDvdaava...rlvaaGaevleppadyyggggll------
00466841   1/1  hhslaltegpap.........glahlafevdsrddldaaaarlraaGvevlrgpgdhepgggrffy----
00496831   1/1  lalmasdggpdagggvhlalevddreevdalyerllaaGtvvmpptdtpwggrfayvrDpdGnlwelv--
00494441   1/1  tsvflalpdgdirleLtepldpeddspiaeflekhlgpGvqhiafeVdDida...averlkaaGvef---
00437371   1/1  lelleppdpdsaiaeflakphggglvhlafevdDidaa...varlraaGvevlgeptdgpgggrvaf---
00360221   1/1  gpdksqiaefldayhgpgvqhiAfrVdDida...averlralGaefldepvdtyglrlafildp------
00465211   1/1  ......dppggggvhlafevddvdaaya...rlkaaGvevllepvlrltepvdepwggreayvrDPdGn-
00530791   1/1  ....apvppggggvhlafevddvdaay...erlkalGveilreptdepwglreavvrDPdGnlielvq--
00442191   1/1  faftfpea......vslylsvddvdeadrlakalaagGkvlmpledtfwggrfgwlaDpfGvsWqlv---
00461591   1/1  .pdsqiaeflekhgpgvqhiAfrVdDadaaverlvarGaefldppdgygevliaairgiggv--------


                         +         -         -         -         -         *         -:210
query           PQQLAQMKDVAHAMVDEWAETKKPPRHTAWLHQKEFADAK------------------------------
00516351   1/1  ----------------------------------------------------------------------
00516341   1/1  ----------------------------------------------------------------------
00478941   1/1  ----------------------------------------------------------------------
00482081   1/1  qdgplvddplvgvlnlvpl---------------------------------------------------
00482091   1/1  ----------------------------------------------------------------------
00497251   1/1  lve-------------------------------------------------------------------
00479851   1/1  ----------------------------------------------------------------------
00480151   1/1  ----------------------------------------------------------------------
00488551   1/1  ----------------------------------------------------------------------
00466831   1/1  ----------------------------------------------------------------------
00494351   1/1  ----------------------------------------------------------------------
00489641   1/1  .var------------------------------------------------------------------
00484121   1/1  adrlllllglplllllllell-------------------------------------------------
00467371   1/1  ----------------------------------------------------------------------
00466821   1/1  DPdGnlielvedg---------------------------------------------------------
00511451   1/1  ----------------------------------------------------------------------
00478301   1/1  ----------------------------------------------------------------------
00460431   1/1  ----------------------------------------------------------------------
00478931   1/1  ----------------------------------------------------------------------
00494431   1/1  DPdG------------------------------------------------------------------
00495351   1/1  ----------------------------------------------------------------------
00479841   1/1  ----------------------------------------------------------------------
00498031   1/1  ----------------------------------------------------------------------
00494341   1/1  ----------------------------------------------------------------------
00490361   1/1  ----------------------------------------------------------------------
00475581   1/1  yfrDPdGn--------------------------------------------------------------
00494361   1/1  ----------------------------------------------------------------------
00520951   1/1  ----------------------------------------------------------------------
00491331   1/1  ----------------------------------------------------------------------
00510651   1/1  ----------------------------------------------------------------------
00495341   1/1  ----------------------------------------------------------------------
00466841   1/1  ----------------------------------------------------------------------
00496831   1/1  ----------------------------------------------------------------------
00494441   1/1  ----------------------------------------------------------------------
00437371   1/1  ----------------------------------------------------------------------
00360221   1/1  ----------------------------------------------------------------------
00465211   1/1  ----------------------------------------------------------------------
00530791   1/1  ----------------------------------------------------------------------
00442191   1/1  ----------------------------------------------------------------------
00461591   1/1  ----------------------------------------------------------------------