[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38755.1


[Show Plain Result]

## Summary of Sequence Search
   1::253
   3::255  1.6e-61 38.6% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   3::252    3e-60 40.4% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   6::233  1.5e-58 36.3% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   4::249  4.6e-58 37.9% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   2::249  5.6e-58 36.4% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   4::249  6.5e-58 37.9% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   3::251  1.7e-57 39.5% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   1::255  3.2e-57 36.9% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   2::249  1.1e-56 37.9% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   4::237  2.6e-56 38.8% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::242    3e-56 39.2% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   1::248  5.5e-56 38.9% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   3::242  8.8e-56 40.5% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   3::254  1.1e-55 37.4% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   5::250  6.8e-55 38.8% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   3::238  1.3e-54 38.7% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   1::242  1.9e-54 38.3% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   3::249  2.6e-54 36.7% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   2::249  4.4e-54 39.8% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   4::237  9.1e-53 33.2% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::245  1.7e-52 33.6% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   4::242    2e-52 38.9% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   9::237  4.8e-51 35.3% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   2::225    1e-48 39.2% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   1::244  5.9e-48 34.2% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   1::243  5.3e-47 39.1% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   2::242  2.4e-45 36.7% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   3::220  5.4e-45 36.2% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   1::243  1.1e-44 37.9% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
  19::248  2.1e-44 40.4% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  10::248  3.2e-44 34.0% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   2::243    5e-43 35.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   5::247  1.1e-42 30.8% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   2::246  3.8e-42 39.9% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   3::250  6.7e-42 35.7% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  24::247  1.9e-41 36.4% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   3::243  3.7e-41 34.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   3::242  1.3e-40 37.9% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  21::248  1.8e-40 32.7% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   3::238  3.5e-40 33.3% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   1::240  1.2e-39 30.9% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   3::249  5.9e-36 29.2% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  18::251  5.9e-35 33.0% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   1::233    4e-34 38.8% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
   3::243    6e-34 33.5% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
   3::236  3.3e-33 35.4% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   3::243  5.3e-33 32.9% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::121  1.2e-30 40.0% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  27::250  2.4e-30 34.2% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  16::245  4.2e-30 36.0% 0053253 00532531 1/1   arboxykinase-like                       
   6::253  7.1e-30 29.9% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  29::197  7.4e-29 32.9% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  27::226  1.2e-28 32.2% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  27::242  6.4e-28 31.4% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  14::232  7.2e-28 35.6% 0047841 00478411 1/1   arboxykinase-like                       
  21::251  1.3e-27 27.9% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  13::244  2.7e-26 26.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  23::183  5.3e-26 32.5% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
   9::225  5.4e-26 33.3% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   4::243    9e-25 32.1% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   4::248  1.9e-24 29.7% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  31::251  1.6e-23 33.3% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  28::204  2.7e-23 29.0% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   5::228    1e-22 35.6% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
   6::209  1.5e-22 26.9% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  26::232  1.7e-22 29.5% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  13::228  2.1e-22 28.2% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  16::209  2.7e-22 36.7% 0047552 00475521 1/1   arboxykinase-like                       
  27::228  7.1e-22 30.9% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  28::216  5.9e-21 30.9% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  28::249  1.2e-20 25.8% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  28::204  1.3e-20 28.6% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  28::225  2.6e-20 23.9% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  28::245  3.9e-20 28.1% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   5::227  1.4e-18 25.1% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  30::255  2.7e-18 27.1% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  24::209  4.7e-18 28.0% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
   9::248    7e-18 24.4% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  28::201    7e-18 29.6% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  26::231  1.8e-17 25.6% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   7::207  3.1e-17 22.0% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  16::226  3.8e-17 30.5% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  29::234  1.1e-16 29.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  14::211  2.3e-16 24.6% 0047844 00478441 1/1   arboxykinase-like                       
  13::249  1.7e-15 28.8% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  28::234  2.8e-15 26.6% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  13::248  3.2e-15 32.3% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  29::255  2.1e-14 26.1% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   6::231  2.9e-14 27.1% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  26::228    1e-13 24.2% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  29::233  1.2e-13 25.0% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  23::207  2.4e-13 32.4% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  30::233  2.6e-13 22.5% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  16::245    6e-13 21.7% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  22::205  1.2e-12 28.6% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  22::231  1.6e-12 22.7% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  30::230  6.7e-12 28.6% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  23::245    1e-11 20.1% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  16::248  4.6e-11 31.2% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  21::240  5.9e-11 23.5% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
   8::242  1.2e-10 29.1% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  23::225  3.7e-10 19.1% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  28::251  4.7e-10 26.2% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  30::178  9.7e-10 24.4% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  18::212  1.3e-09 26.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  28::226  1.5e-09 27.3% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  23::250  2.4e-09 20.9% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  20::243  5.5e-09 27.3% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  29::250  8.4e-09 23.8% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  13::63   1.3e-08 36.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  22::247  2.8e-08 27.7% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  28::216  4.2e-08 27.8% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  28::191    6e-08 24.4% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  18::221  6.7e-08 22.6% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  34::220    2e-07 28.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  25::215  4.2e-07 26.5% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  26::225  4.6e-07 23.1% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   7::212  5.7e-07 23.3% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  22::252  7.1e-07 21.9% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  25::64   2.4e-06 27.5% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  21::249  2.5e-06 26.9% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  21::65   2.9e-06 33.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  23::178  3.1e-06 25.2% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   5::178  3.4e-06 23.3% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   2::51   3.7e-06 32.0% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   2::248  4.6e-06 24.2% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  26::224  6.1e-06 23.8% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
   7::249  6.7e-06 26.4% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  29::228  1.7e-05 23.6% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  17::229  1.8e-05 20.9% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  14::51   2.6e-05 31.6% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  28::206  3.1e-05 22.2% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  25::249  6.2e-05 18.6% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  24::255  0.00012 16.9% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  25::65   0.00019 39.0% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  28::55   0.00032 42.9% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   4::177  0.00035 23.6% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  20::85   0.00037 25.8% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  29::252  0.00044 19.2% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  28::181  0.00049 23.4% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  29::178  0.00051 27.3% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  29::220  0.00055 20.2% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
   1::253


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL
00379581   1/1  --lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldi
00475891   1/1  --lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00390411   1/1  -----MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirr
00490801   1/1  ---llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeival
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00510251   1/1  ---lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeiv
00475991   1/1  --lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpts
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00422801   1/1  ---llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllk
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00500441   1/1  --lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgk
00530591   1/1  --llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagll
00404101   1/1  ----elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltal
00466971   1/1  --llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkd
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00361211   1/1  --plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvl
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00367901   1/1  ---lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidli
00509431   1/1  M..lelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsd
00425571   1/1  ---lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllal
00466931   1/1  --------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdi
00436071   1/1  -pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla.
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00495371   1/1  -esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlv
00436511   1/1  --ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikk
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00448931   1/1  ------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarl
00485451   1/1  ---------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggk
00500611   1/1  -pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgei
00496111   1/1  ----elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglels
00469451   1/1  -allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkd
00367481   1/1  --yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllp
00485931   1/1  -----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi...
00488521   1/1  --lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGe
00379601   1/1  --llelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel..
00468601   1/1  --------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyra
00424961   1/1  --lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglld
00503371   1/1  Mmlksle.....lknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdll
00422141   1/1  --dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifl
00475371   1/1  -----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrp
00464791   1/1  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGer
00437981   1/1  --lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldg
00371631   1/1  --mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrll
00495031   1/1  --lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplg
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00414121   1/1  --------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeili
00532531   1/1  ---------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinle
00489571   1/1  -----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.............
00381441   1/1  ----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprl
00477971   1/1  --------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttr...
00457311   1/1  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00478411   1/1  -------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldgdlv.rl
00490731   1/1  --------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrp
00368501   1/1  ------------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGp
00480471   1/1  ----------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgei
00434401   1/1  --------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr
00437941   1/1  ---lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvr
00379961   1/1  ---yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsd
00512891   1/1  ------------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv..
00515531   1/1  ---------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieid
00503741   1/1  ----fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLak
00356411   1/1  -----lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgv
00464411   1/1  -------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsge
00462761   1/1  ------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddl
00475521   1/1  ---------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdgdlv..
00426051   1/1  --------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdl
00475381   1/1  ---------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlav
00496571   1/1  ---------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirg
00484101   1/1  ---------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrl
00533501   1/1  ---------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigt
00493431   1/1  ---------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttrepr
00368571   1/1  ----dgdglgvllGkll..dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkg
00487021   1/1  -----------------------------rmkiivltGpsGsGKsTlarlLaell.........gvvvid
00451571   1/1  -----------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl...
00379261   1/1  --------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGK
00515511   1/1  ---------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieid
00468951   1/1  -------------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgi
00477011   1/1  ------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptel
00404191   1/1  ---------------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlaka
00405881   1/1  ----------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgv
00478441   1/1  -------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdddlvll.
00406781   1/1  ------------aglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase......
00510561   1/1  ---------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGik
00392701   1/1  ------------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd......
00532471   1/1  ----------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdv
00498531   1/1  -----ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGglprGsltliaGp
00439861   1/1  -------------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalq
00498811   1/1  ----------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddlt
00432181   1/1  ----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlg
00480441   1/1  -----------------------------rlivllGpsGaGKsTlaklLaell.p..glivisvgdttr.
00513251   1/1  ---------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr..
00508671   1/1  ---------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsg
00517691   1/1  ---------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg......
00513761   1/1  -----------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDpara
00470731   1/1  ----------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTl
00386741   1/1  ---------------lealkavllgirpgehllLvGppGtGKTtlaralagelga...............
00480251   1/1  --------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr
00444381   1/1  -------lledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpgenvlLvGpp
00511381   1/1  ----------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtr
00499191   1/1  ---------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd.........
00469161   1/1  -----------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgt
00394721   1/1  -----------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv.
00489631   1/1  ---------------------------MkgklillvGppGsGKtTlaraLaell.glpf.iridgddllr
00499331   1/1  ----------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllr
00420941   1/1  -------------------lglslgirpgkgvllyGppGtGKTtlakalagel...gapf..........
00478081   1/1  ----------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidt.....
00410321   1/1  ------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp.eygptig-------
00437901   1/1  ---------------------lslgirpgrillLyGppGvGKTtlakalakel.gapvieidaselrd..
00519581   1/1  ---------------------------kpkvilltGppGvGKttlarlLakll.........glpliidl
00476071   1/1  ---------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll.
00527261   1/1  -----------------npfilgpkvdledfigreeelkeleeal.pk.ivlltGprGsGKTtllkalak
00402371   1/1  ---------------------------------lvGppGvGKTtlaralagllvrssgpilldgvpf...
00472911   1/1  ------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglag
00515351   1/1  -------------------------mn.gklivltGppGsGKtTlaraLaerlglpvistddllreav..
00437921   1/1  ------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsg
00409841   1/1  ---------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilg
00401211   1/1  ------------------------elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelerg------
00521551   1/1  --------------------flslglrpgkgvlLvGppGtGKTtlaralagllga...............
00495771   1/1  --------------------dilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdgg-----
00533151   1/1  ----------------------MsldikkgklivltGppGsGKtTlarlLaerl.........glpfist
00416171   1/1  ----diigqeeakka..llealslaartgenvllvGppGtGKttlaralakllpr...............
00471271   1/1  -prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLln-------------------
00473941   1/1  -eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga........
00482551   1/1  -------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaa
00367291   1/1  ------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanelga
00509891   1/1  ----------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrl
00410531   1/1  ----------------gelknlslelkkglkillvGlngvGKTtllkrlag...................
00378621   1/1  -------------glklllrrlslllkkglkvllvGlpgvGKstllnrlag-------------------
00487061   1/1  ---------------------------ldMkkgklIvieGppGsGKtTlakaLaer..gargldvvviye
00478391   1/1  ------------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllr
00489391   1/1  -----------------------lsikkgklivltGppGsGKtTlakaLaerl.....glpv...istdd
00420081   1/1  ------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgE-----
00478131   1/1  ---------------------------kgkvivltGppGsGKtTlarlLaellkp---------------
00430121   1/1  ---iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKT
00414001   1/1  -------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypftTldpnlg
00480501   1/1  ----------------------------MgklillvGppGsGKtTlaralaell.g..gvvvidgddlrr
00461621   1/1  ---------------------------mkgmiialtGppGsGKsTlaklLaerlglpf.istddlyrevv
00496061   1/1  ----------------------------gklivltGppGsGKtTlaklLaerl.........glpvistd
00483811   1/1  ----------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellr


                         -         -         *         -         -         -         -:140
query           APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYVG
00379581   1/1  talslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaea..rervlelle
00475891   1/1  dilglsllellrrgigyvfqdpalfpgltvlenlllglll...............lglalkeaalralll
00390411   1/1  gadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrg
00490801   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00458601   1/1  spqelrrlggvvvqevllffltllenlllgla.llllllvlllllllllllllaakeaalralllllllg
00510251   1/1  alvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll........
00475991   1/1  Geilldgkdildlslael..rgigyvfqqdallpsltvlenlllglllagelll.........lllaake
00482201   1/1  slkel..rgigyvvqqdallpsltvlenl..........llgllllgllllllaakeaalralllllllg
00482261   1/1  slael..rgigyvfqqdallpsltvlenlllgllllgellll.........llaakeaalralllllllg
00422801   1/1  llagllkptsGeilldgldilalslaelrr.rigyvfqdpalfp.ltvrenlalgllla...........
00378981   1/1  slaelllllrrgigyvfqdpalfpgltvrenlalgll...............laglskaeaaaraaelle
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00500441   1/1  dildlsl...lrrgigyvfqdpalfpgltvlenlllgll...............llglslaeaaeralel
00530591   1/1  kptsGeilldgkditdlslkel..rgigyvvqqdallpsltvlenl..........llgllllgllllll
00404101   1/1  slael.rrgigyvfqdpalfpgltvrenlalgll....................kaeararalellellg
00466971   1/1  ilglslaelllllrrgigyvfqdpalfpgltvlenlllgl...........lllglllllaakeaalrle
00420701   1/1  llslaellalrrgigyvfqdpalfpgltvrenlalg...............lllaglskaeararalell
00361211   1/1  ldgleisalslaerlragigyvfqdlalfpeltvlenlalg............................r
00502741   1/1  slael..rgigyvfqqlallpsltvlenlalgllll...............glskaeaaaraaellellg
00367901   1/1  lkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr.ligyvpqdpalf
00509431   1/1  liflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrr.lig
00425571   1/1  sl...lrrrigyvfqdpalfpgltvrenlalgllll...............glskaeaaaralellellg
00466931   1/1  lalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallld
00436071   1/1  .....lrrgigyvfqdpalfpgltvlenlalgllllgll.................ealaralellellg
00498251   1/1  Lalrllagllkpgggvvyidgeesldll....rarrlgvvlqelllfpeltveenl..............
00372301   1/1  vdgedlr...........igyvfq..............................................
00495371   1/1  dgldltglspa...rggiglvfqteallppltvrenlealgldlrglld..................rer
00436511   1/1  GervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpal
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre...lrrrigyvfqdpalfpeltvlenlal
00448931   1/1  a....areqlgivfqdp....gltvlenlalg........................eleararellellg
00485451   1/1  vlvigldifrlsarelrkrig...vfqdpallphltvpenldlglll.....................ei
00500611   1/1  llggkvlyisleeslrrrrigmvfqelgldpdltv................................are
00496111   1/1  aeelrerr.rrigyvfqepalfpeltvlenlalgll..................................
00469451   1/1  vlylsleesleq.lrrrigyvfqdpalfp........................................a
00367481   1/1  asggilvpgedalll.......................................................
00485931   1/1  .......rrigavpqlpvlfprltvlenlalgg......................adlaeraeellellg
00488521   1/1  i................ggkvlyvdqeeslfp.ltvlenlalg..........................g
00379601   1/1  .....lrnkigyvfQdpv.lfpltvren..........................................
00468601   1/1  aaae..rlgigavpqdvplfpsltvldnlala..........rdlleaakaagydvvlidta.......g
00424961   1/1  pdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialga...............e
00503371   1/1  iylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvs.lkeliel
00422141   1/1  deeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledl
00475371   1/1  sarellg........................................................llgellg
00464791   1/1  vglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerprevrellglllelgvlf.............
00437981   1/1  kdi.........rrgiglvfqliglfphltvlelvalgl.ggilveevrellkel...............
00371631   1/1  gklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeql..krigl
00495031   1/1  gkvlyigleltlsperlrlraqsl................................gldldellerllvi
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyv-------------------
00414121   1/1  dgqll.edlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilid.................
00532531   1/1  ggfyakaigllrrkigyvfq...lfpfltvlenvalgld.................glvdeedleraenl
00489571   1/1  ......................................................................
00381441   1/1  gevdgvdltfls.....reeigyvfqepallpdltvlenlylglllalllaleegkivildgd......r
00477971   1/1  pprpgevdgvgyvfqsrelfpeltvagnfleg...............aevrgnlygtsrerveellea.g
00457311   1/1  klsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk.......................
00478411   1/1  glkd....gigmvfqdpalfplltvrengvalglllag..............lskaeieervdlllelvg
00490731   1/1  aadellgvlaee........................................................lg
00368501   1/1  pGvGKTtlaralakllga..pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlen
00480471   1/1  lldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllg.....ldllllellkel
00434401   1/1  paaelllreglgidfqlpdal.....................................drellreevlel
00437941   1/1  vlgidaselld...........................................................
00379961   1/1  lldpkdlrellragiplvflnfaalpasllesel....................................
00512891   1/1  ....rsarrgigyvfq........tveellgllaelvgle...........................vrg
00515531   1/1  gvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenl...
00503741   1/1  llagllkpkfgeillfgkvvyvnvselldlkellrll.................................
00356411   1/1  kltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi
00464411   1/1  plge....ligevfqdgilfpdltvlenvalgry..............gllglikealaegvivildrvg
00462761   1/1  r.......lglliglvfqdpdllpfltvlenvllpllaagliv....................ivdgtll
00475521   1/1  ..dleplrrdigmvfqdpalfplltvrenvilgllelag..............lskaealarvdellelv
00426051   1/1  ggesglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgl..................lirgdee
00475381   1/1  lsrdllgllreglirigyvfqdyalfprltvlenvllgll..............................
00496571   1/1  eplgelir...glvfqdpllldeltvlen.............lalgrylhl.glilaalaagvgvvldrv
00484101   1/1  dldellg..igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalp
00533501   1/1  p.....lgrgigyvfqdpalfpgltvrenlelll........vfadrygvlrglikpalaegvsvildrv
00493431   1/1  pgev...rgigyvfqsgalfphlivagnlleg.......aevhgllygtskerveealekgllvlldr..
00368571   1/1  eyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgr......geddfftpaarallr
00487021   1/1  tddllra.....gevfqdyalfphltvlelldnvllgleir.gllk..............aerlervevl
00451571   1/1  .....lreaiglvtqdgelllelid.egilvpdeiv..............iellrealeeldadgvildg
00379261   1/1  TtlaralAkll.gapfvevdaselteggyvgedlekr.irelfqearllvfltvlenirldaseylekrv
00515511   1/1  gvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanv
00468951   1/1  kaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid....teesldqlrarrlgld
00477011   1/1  rlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpia....................
00404191   1/1  lanelkkrggrvlyvsa.....................................................
00405881   1/1  veldd..................................grqlvlvDtpGlielaslgeglvrqaleale
00478441   1/1  ...elrgrdilmvfqppalfpllevr................glniaevlelaglskaealkrvdlvlel
00406781   1/1  ......................................................................
00510561   1/1  aLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyis...teesleqlrarrlgldld
00392701   1/1  ......................................................................
00532471   1/1  gelggaalldivde..grliglvfqdldllpllevlellaa.............................
00498531   1/1  pGsGKTtlalqlaanlaklggkvlyis...teesleqlrarrlgldldellllpaltveellala.....
00439861   1/1  laanlaknggkvlyisleesreqllera.erlgldleellllgll.........................
00498811   1/1  .relvaggglliglifqdfglfelldrellielllenlalglal........egvildalrrrllelldl
00432181   1/1  vveldgrkl.............................................................
00480441   1/1  epregevlgvdyvfvdrelfeelivagnlled...................aivhgllygtskerieeal
00513251   1/1  ......................................................................
00508671   1/1  vvlldgddlraglsiglilsdedraalrrr.lgevfqelllagrlvvldgtalglel.............
00517691   1/1  .........................................................gtlllllgllsfl
00513761   1/1  nlpeqlgidirdlidletvmelglgpngalvfa................................leell
00470731   1/1  aralakel..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidall..rkgpdvil
00386741   1/1  ......................................................................
00480251   1/1  psapeqlgi.lgellg..........vpvvgvltgldlagalrealell.llegydvvliDtag......
00444381   1/1  GtGKTtlakalakll.gvpfiridgseltekelvGe..................................
00511381   1/1  lgielvvsriglvleavglffaldllelll........................................
00499191   1/1  ......................gllvgvvfqddfylllpalevlengaflldlllpdaldrelllellla
00469161   1/1  plgelirelllegfqdlilvpdllvlellaan..............raglrelikellaagkgvildrfp
00394721   1/1  ....................................................................vr
00489631   1/1  ellgellgrgigfgfqqgdlledatvlenlalllldeidka.............................
00499331   1/1  epvig..agtdigevfqdlllaggllvddev.............................rrlllealde
00420941   1/1  ..................................................................irid
00478081   1/1  ......................................................ddlrreairelllgld
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ......................................................................
00519581   1/1  dalaellfgdvgglvvdli...................................................
00476071   1/1  ggpllerirellgegyllfdealdrellaallfglelegal.............................
00527261   1/1  elgkpviyidlselsskgyvdleellrelaeelgell.................................
00402371   1/1  ..................................................................vrld
00472911   1/1  eggkpl................................................................
00515351   1/1  .......pggtdigelfqdyllfpfltvdeni.........rglllealeellaagkvvild........
00437921   1/1  ggvdvieldasdlrgvddlreligevlqalglllgg..................................
00409841   1/1  v.....................................................................
00401211   1/1  ----------------------------------------------------------------------
00521551   1/1  ................................................................pfvrls
00495771   1/1  ----------------------------------------------------------------------
00533151   1/1  ddllrelvpggldig..........................evfqdaleaglllfddefrglller....
00416171   1/1  ....................................................sgvpfvrvncsaltedll
00471271   1/1  ----------------------------------------------------------------------
00473941   1/1  ......................................................................
00482551   1/1  naalplelgklggkvlyisteeafsperlreralsl..................................
00367291   1/1  ......................................................................
00509891   1/1  d............................................ldeplgvdr.erlrrvgelalllag
00410531   1/1  ...............................................................gefv..d
00378621   1/1  ----------------------------------------------------------------------
00487061   1/1  pvdywaavgggdllrlirelllrlg.....................................fgepdafd
00478391   1/1  elvgeggrlgrd.lfdedrllfrellideidl......................................
00489391   1/1  llreavpggtdlgel..........fqdlllegellfideiaelllealae...................
00420081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00430121   1/1  tlakalagllfp..........................................................
00414001   1/1  vvelpderldllagl-------------------------------------------------------
00480501   1/1  alvggl..............................................................id
00461621   1/1  ergtelgklikdyfdpgalvpd.llirlllerllfldeg..................ggflldgfprtle
00496061   1/1  dllreevepggtdlg........eifqalllagel.lfddevlgll....rerldelielllagg..vvi
00483811   1/1  gllgqpk...............................................................


                         +         -         -         -         -         *         -:210
query           LEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHD
00379581   1/1  lvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllv
00475891   1/1  llllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvl
00390411   1/1  iglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllellegl
00490801   1/1  ................lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlll
00458601   1/1  ledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHd
00510251   1/1  ..................lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdl
00475991   1/1  aalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrel
00482201   1/1  letlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthd
00482261   1/1  letlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthd
00422801   1/1  llllglskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpe
00378981   1/1  llglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvll
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00500441   1/1  llllgledlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltv
00530591   1/1  aakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellel
00404101   1/1  ldelldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakeglt
00466971   1/1  llllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakeglt
00420701   1/1  ellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvl
00361211   1/1  arellerlglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellell
00502741   1/1  ledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthd
00367901   1/1  pqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeell
00509431   1/1  yvpqdpnllfqltvlenlllg..peerrelldellglellsleealaraeealeelnallkeleeeleli
00425571   1/1  lddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvth
00466931   1/1  lllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvs
00436071   1/1  lgdl.drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvth
00498251   1/1  ................................drlprllsggqrqrvvidsalalrpkllllDEPtsgld
00372301   1/1  ...llervgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellael
00495371   1/1  viellelvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlake
00436511   1/1  pallrllalfpaltvaenlrfgl....glavlllldsatrlaqakreisalarellervglpgdlftlls
00468691   1/1  gallag...............................lglaeyldelgkdLSgGqrqrvalAr.....pv
00448931   1/1  ledydvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel..
00485451   1/1  lervlellelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrt
00500611   1/1  rviellelvgllelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrl
00496111   1/1  .......drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkel
00469451   1/1  eellelvgledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkel
00367481   1/1  .....rvdeiltrvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeall
00485931   1/1  legfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel..
00488521   1/1  edveellerlgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvs
00379601   1/1  .....................laralrqdPdilllDEptsalda....e...llqallt.ghtvvlvthh
00468601   1/1  lld.ldrlvgelsggqkqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKl
00424961   1/1  yfrdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlv
00503371   1/1  lldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekrle
00422141   1/1  glsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedpieyvfqspnlfpl
00475371   1/1  ldvlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvd
00464791   1/1  ..............................aaellervglvaatadeppgelsggqrqrlaiAraladdq
00437981   1/1  .................lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtv
00371631   1/1  lfq.kglpealdveellellldlkegle...................................dilvpvl
00495031   1/1  dllelvgllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelg
00387201   1/1  ----------------------------------------------------------------------
00414121   1/1  ......................sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkel
00532531   1/1  lalvgleeipnrypselsgGqqqrv...........illldEPtsgLdpvsr..................
00489571   1/1  ................lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth
00381441   1/1  eraeellellgldadlviilpasleellerldrrggelsggqkqRvalarallldpd-------------
00477971   1/1  ldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnh
00457311   1/1  llepvglpevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadl
00478411   1/1  lddlldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee..........
00490731   1/1  ldvllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvv
00368501   1/1  lalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallggg
00480471   1/1  kydpvilllnkidllddrllrraeaeerieellelvglsallg---------------------------
00434401   1/1  lglgevvivdvydlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvd
00437941   1/1  .................pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.g
00379961   1/1  ................lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleeg
00512891   1/1  eleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttn
00515531   1/1  ..........anvpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalara------
00503741   1/1  .......................lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpe
00356411   1/1  ................ilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalaralakdp-
00464411   1/1  lsdla..ypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllekleyikkrleh
00462761   1/1  lvglrealrkllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplyga
00475521   1/1  glddellldrlp...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveeilell-
00426051   1/1  leaalelaglprvielllegldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkr
00475381   1/1  .........llgglvvildggvrqrlalarallldpdvllldeplllldaalr...........dlpdlv
00496571   1/1  glsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevl
00484101   1/1  lilel......relsdgqiqrvaparallrdpllllldedtvvldkvdlasildlllellee.i------
00533501   1/1  glsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrl
00493431   1/1  ..........dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgpliey
00368571   1/1  alilalaeepe..ptldellellselglrdladrleklvagglagllegaektaasilellrkllallld
00487021   1/1  lervgl..lldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpeg
00451571   1/1  fprllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild-
00379261   1/1  vsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelll
00515511   1/1  pi...............llvlnKiDlleaklvllllvglfdlldglpselsggqkqrvala---------
00468951   1/1  lddllllpaltveellala..............................................erlls
00477011   1/1  ......gisrdairleielpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillv---
00404191   1/1  ...........................delvsklsgglqeqrvaiafalarkpdllllDEidalgldpel
00405881   1/1  radvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDep....tneldlellellee
00478441   1/1  vgld...drypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidallelvd
00406781   1/1  ...llgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleel
00510561   1/1  rlllldaltv..............................................eellalaerllsgg
00392701   1/1  ...llgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrllegl
00532471   1/1  .........rleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlles
00498531   1/1  .........................................erllsggkpdlvviDsltalapsllllde
00439861   1/1  ........................siliadplglsgeellrvllalalelkpdlliiDeltalldaervr
00498811   1/1  l.......gldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelapl
00432181   1/1  .....vliDtpGleefa.......sggekqrvalalallreadvlllvvdadeptsfldle....ll---
00480441   1/1  da.glgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyee
00513251   1/1  ..............gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatsp
00508671   1/1  ..rdelrellkeaglpll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdl-----
00517691   1/1  lalvldslplerergitidvalarllldgrkilllDtP..Ghed....fvkevlralrladgallvvdad
00513761   1/1  ttldillealell.eedydyiliDtpGglelrallallla...............iaral.aadeillvd
00470731   1/1  dgag.rtpeqlealldlleelgrpvvviilttnr.............evlldral.rRpgrllldep..e
00386741   1/1  ..pfvrldaselsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivggglltel
00480251   1/1  ...............glqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvlt
00444381   1/1  ........................................segailsggfkqrvgia..lladpgilflD
00511381   1/1  ...........................qdpdviliDE.aqfldp....evvevlleladtgilvlvtgle
00499191   1/1  lveglvvlldryprllsggqrqrvaia.....dpdvlildgptllldpe.....................
00469161   1/1  lsrl....ayqlsggerqrlaidlegalllerllldep--------------------------------
00394721   1/1  ldlsellsvsdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnv
00489631   1/1  .ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleer
00499331   1/1  lllaggkvvildgfpggllqrealrrllprpdlvilldap...........peelleRllkrgrldgred
00420941   1/1  gsellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldgl
00478081   1/1  lleilf.eglllsdefrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifld
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  .vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvli
00519581   1/1  ...........dleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfelifit
00476071   1/1  ..........ldglvygvlqdrllerllaagpdvlildgpl.lldvellpl-------------------
00527261   1/1  ....ellkkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqsll.dvss
00402371   1/1  asellefgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...
00472911   1/1  .......gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvif
00515351   1/1  .............glsggllqrvallrallrpdlvifldapleelleRllkRddseeeilerleryreel
00437921   1/1  .........................................kpdvlllDEi.drldpdaqnallklleel
00409841   1/1  .........................vlldgrdllllDtPGlidfaseptnlldleiieallraleeadvv
00401211   1/1  ----------------------------------------------------------------------
00521551   1/1  aselvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegl
00495771   1/1  ----------------------------------------------------------------------
00533151   1/1  ..leellargpvvildgfpggllqrealrrlllrpdlv--------------------------------
00416171   1/1  eselfghekgafgggekqrlgllrla..dggvlflDEi--------------------------------
00471271   1/1  ----------------------------------------------------------------------
00473941   1/1  .pfielsasdllg.......esdlrggfkqa...akpgvlflDEidrl.drevqnaLlelleelqvtilg
00482551   1/1  ...gldleelldrllvidatdlldllellerlrrllsegkvdlvviDslallarael..ldepllgldar
00367291   1/1  .........pfirvdaselle..klvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpe
00509891   1/1  ..gglcalvaddlagaleel.laralaggpdviliEgagllplp........liellrdlldlvvlvvld
00410531   1/1  ygptigvnfktvevdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellgla
00378621   1/1  ----------------------------------------------------------------------
00487061   1/1  n.ellgellealleg............gki.vlsarraqlleirlirpllaegkvvilDrepdsad----
00478391   1/1  ..........................llakgkvvildgtn......lsealdealrrllrpdlvifldap
00489391   1/1  ...........................aegkvvildgtg..ldieqrealrelllel.prpdlvifldad
00420081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00430121   1/1  .........sgvpfirinlseltekllvselighppg---------------------------------
00414001   1/1  ----------------------------------------------------------------------
00480501   1/1  gllilfledeaalselvlevllealegggnpdvvildgt..nlleedrellrellkrlgrpdlvifldap
00461621   1/1  qaeals.....kpavlsggrkqrlalaralavdpe.lildg-----------------------------
00496061   1/1  ldgf....pldlegalllrealarallpdl.vifldap--------------------------------
00483811   1/1  lydlleellellldegekipveliiellkdvlvsdpdviilDelpgtnlklqdletlssvaktlnfpdyv


                         -         -         -         +         -         -         -:280
query           MKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLGTAA---------------------------
00379581   1/1  thdldealrladrilvlddGrivelgtpeellenpgllglllgee-------------------------
00475891   1/1  lvthdldealrladrilvlddGrivelgtpeellenpgllaa----------------------------
00390411   1/1  keeaekakalleelkelekllla-----------------------------------------------
00490801   1/1  LDEPtsgLDpetraellellrelakegktvllvtHdlse-------------------------------
00458601   1/1  ldealrladrilvlddGriveegtpeellenplllytll-------------------------------
00510251   1/1  lllDEPtsgLDpetraellellrelakegktvllvtHdl-------------------------------
00475991   1/1  akegltvllvtHdlsealrladrilvlddGriveegtpeel-----------------------------
00482201   1/1  lsea.rladrilvlddGrivelgtpeellenpgllytllllgeel-------------------------
00482261   1/1  lseal.ladrilvlddGrivelgtpeellenpgllytll-------------------------------
00422801   1/1  traellellrelak.gltvllvthdls-------------------------------------------
00378981   1/1  vthdlsealrladrilvlddGrivelgtpeel--------------------------------------
00440861   1/1  pglvvlisaltgegldeltvrenlalg...........--------------------------------
00500441   1/1  llvthdlsealrladrilvlddGrivelgtpe--------------------------------------
00530591   1/1  lrelak.gltvllvtHdlseal.ladrilvlddGriveegtpee--------------------------
00404101   1/1  vllvthdldealrladrilvlddGrivelgtpeellenpl------------------------------
00466971   1/1  vllvthdldealrladrilvlddGrive------------------------------------------
00420701   1/1  lvthdlsealrladrilvlddGrivelgtpee--------------------------------------
00361211   1/1  kelakelgvtvilvthdldlldsallrpgkrpllsdlrg-------------------------------
00502741   1/1  ldealrladrilvlddGrivelgtpeellenpgllytll-------------------------------
00367901   1/1  ellglgglldrpvstLSgGekqrvala-------------------------------------------
00509431   1/1  gplldglellvglnglldrplselSgGekqrlala-----------------------------------
00425571   1/1  dlsealaladrilvlddGrivelgtpeellen--------------------------------------
00466931   1/1  tLSGGerqrvalaralalallllsdpp-------------------------------------------
00436071   1/1  dldlalaladrivvl-------------------------------------------------------
00498251   1/1  plsarellellrrllrlakelgvtvllvthdlde------------------------------------
00372301   1/1  gatvlfvtHdlelaalladrvvvlndgrivavg-------------------------------------
00495371   1/1  lgvtvllvthdleeveeladrvavlaggrive--------------------------------------
00436511   1/1  rlderagnlS------------------------------------------------------------
00468691   1/1  lLllDEptsgldalr..eilellrellkelgyt-------------------------------------
00448931   1/1  .gltvlvvthlDllakggadlslaleladrilvlgdGe--------------------------------
00485451   1/1  dldkelgrtiilvthdlreae..adrilvlrkgdivel--------------------------------
00500611   1/1  akelgvtvllvthdlreveeladkrdrvvvlrg-------------------------------------
00496111   1/1  gvtvilvthdleeaedladsgriavladgrivlegdl---------------------------------
00469451   1/1  akelgvtvilvtH........Asdrvlvlrdgrive----------------------------------
00367481   1/1  ellaellgatvlvvtHdlelaalaadrivvln.grvvadg------------------------------
00485931   1/1  .gltvlvvthddgtakggaalslaleladrilvlgdG---------------------------------
00488521   1/1  llrellrlLkrlakelgvtvllvthdldevarl-------------------------------------
00379601   1/1  lntaldladriivlddGriveegtpeellanp--------------------------------------
00468601   1/1  DgtakgghdlslalrladrilvlgvGeivedgtpfell--------------------------------
00424961   1/1  eggsdpdllllDeptsalDgeivlslll------------------------------------------
00503371   1/1  llekeleeleellerlealekaleeleerl----------------------------------------
00422141   1/1  .......................................-------------------------------
00475371   1/1  athdldavlkaadrilvldlggivlnkldlvakggaalela-----------------------------
00464791   1/1  gkpvllllDEptsgldal..rei-----------------------------------------------
00437981   1/1  ilathdlsellpallsrcqvirfpplseeelle-------------------------------------
00371631   1/1  sggqkqrlalaralvedpdvlilDgp--------------------------------------------
00495031   1/1  vtvilvthdlrevegrleladrvvvlrggrile-------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00414121   1/1  aeqlgltvlivlnKiDllselthdlellreladrilvlgd------------------------------
00532531   1/1  .........leladriyvllsGrivesgtteellt-----------------------------------
00489571   1/1  .ldeaer.aDrvavldd......Gtpeellarpanpyvrellg---------------------------
00381441   1/1  ----------------------------------------------------------------------
00477971   1/1  dleealelldrilvll------------------------------------------------------
00457311   1/1  gltlirlitrdlgeagrsadrvl....grive--------------------------------------
00478411   1/1  .......ldiilalelllldel------------------------------------------------
00490731   1/1  datlgleaadrilvlleglgvpgvvlNkldlvaeggaalel-----------------------------
00368501   1/1  relrdgellkalkeaeaeellellglkdlllrkp------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00434401   1/1  hdlevalerrlkrlg-------------------------------------------------------
00437941   1/1  vtvilttnrleeldpallsRfdviefpppdeee-------------------------------------
00379961   1/1  evtieragitlllpagvtviaatnddlgeldpalldRf--------------------------------
00512891   1/1  dldel.eladriallrrgri.velgplseeelleilrrrln-----------------------------
00515531   1/1  ----------------------------------------------------------------------
00503741   1/1  tlspdvlelLlrlleegk----------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00464411   1/1  ylelaepykddvvvidangsie------------------------------------------------
00462761   1/1  diviithdls.ieevadr----------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ltrpgldadteeellell----------------------------------------------------
00475381   1/1  ifldad----------------------------------------------------------------
00496571   1/1  ehrleraeeladrlialyegavvvidasglsleevveei-------------------------------
00484101   1/1  ----------------------------------------------------------------------
00533501   1/1  ehylellekad.rvv-------------------------------------------------------
00493431   1/1  dyvivnddleealeelldiivvlllglilqpgsll-----------------------------------
00368571   1/1  lggpafdlrdllslgeg-----------------------------------------------------
00487021   1/1  ilpdlvifldadpeell...eR....llkRgresergepldllee-------------------------
00451571   1/1  ----------------------------------------------------------------------
00379261   1/1  ellddvgltdllgrtvdfkntiiiltsnvgelsggqrq--------------------------------
00515511   1/1  ----------------------------------------------------------------------
00468951   1/1  ggkpqlvviDsltalrpalll-------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00404191   1/1  qeellelldelaergv------------------------------------------------------
00405881   1/1  ...lggtvvlvSahdgegldelld----------------------------------------------
00478441   1/1  r---------------------------------------------------------------------
00406781   1/1  rllsgvtviattndleeldpallrpgrfdrvielplpdl-------------------------------
00510561   1/1  kvdlvviDsltalapalelsllld----------------------------------------------
00392701   1/1  rllsgvtviattnrpeeldpallrpgrfdriieldlpd--------------------------------
00532471   1/1  lllvlplpdlviyldadpeell...eRllkRgrdpeeqe....rl-------------------------
00498531   1/1  pgrvtqgldarllreilrllk-------------------------------------------------
00439861   1/1  elrellralkrlakelgv----------------------------------------------------
00498811   1/1  ygaadividnd.lsleevvdril-----------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00480441   1/1  lgladvvivnddleealelllai-----------------------------------------------
00513251   1/1  evlierlldrvllldegslvdlgvledllaslepl-----------------------------------
00508671   1/1  ----------------------------------------------------------------------
00517691   1/1  egvslpqtrevlllllllgvp-------------------------------------------------
00513761   1/1  dptsgldaetqleilellle--------------------------------------------------
00470731   1/1  ldppdreerleilkrllkklgtvldvthddel.ar-----------------------------------
00386741   1/1  dglllpsgvlviattnrpelldpallsRfdlvielppp--------------------------------
00480251   1/1  kldlvaalgaalsvalilglpilflgtgen----------------------------------------
00444381   1/1  EidkllddrgeaegggdvsregvqnaLlrlle--------------------------------------
00511381   1/1  mdfagelfegsllLl-------------------------------------------------------
00499191   1/1  .......lrpladlvifldaspeelleRllkRgrlergddl-----------------------------
00469161   1/1  ----------------------------------------------------------------------
00394721   1/1  lv--------------------------------------------------------------------
00489631   1/1  y..radlvivtddlev------------------------------------------------------
00499331   1/1  dslellekrleryeeltrdlielyeeadrvividaglsie------------------------------
00420941   1/1  qalsnvtviattnrpeeldpallrpgRfdlvie-------------------------------------
00478081   1/1  adpevlleRllkRgrrerkddseevlellekrleryepll------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ilttndpe...eldpallrRfdiiefpppdeeellei---------------------------------
00519581   1/1  hdedel----------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00527261   1/1  kelleaLlrll-----------------------------------------------------------
00402371   1/1  nvrviaatnr------------------------------------------------------------
00472911   1/1  ldadp-----------------------------------------------------------------
00515351   1/1  eplleeyddalvvid-------------------------------------------------------
00437921   1/1  .p--------------------------------------------------------------------
00409841   1/1  llvvdadrglleqdlellelllelgkpvilvlNKiDlldaee----------------------------
00401211   1/1  ----------------------------------------------------------------------
00521551   1/1  edlsnvlviaatnrpe...eldpallrpgRfdlvielpl-------------------------------
00495771   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00473941   1/1  gglvvvelllllpsgvlviaatnrpelldpallsRfdl--------------------------------
00482551   1/1  elrellrlLkrlak--------------------------------------------------------
00367291   1/1  vqnaLlrlleelrvlsgvlviattnrpee...ldpallr-------------------------------
00509891   1/1  givllvdaidrleaadll----------------------------------------------------
00410531   1/1  glegvpiilvgnKlDllda---------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00478391   1/1  leelleRllkr.....grhpeseevleerleryepllep-------------------------------
00489391   1/1  peelleRllkrglrpe...........regdseevlekrleryle-------------------------
00420081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00480501   1/1  leellerllkr.....gredlslevllkrle.plyeelilpt----------------------------
00461621   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00483811   1/1  vvltvdleii------------------------------------------------------------