[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38782.1


[Show Plain Result]

## Summary of Sequence Search
   1::258
   1::258  2.1e-88 46.1% 0050444 00504441 1/1   crotonase                               
   2::255  1.9e-87 45.8% 0052793 00527931 1/1   crotonase                               
   1::257  1.4e-83 45.9% 0046300 00463001 1/1   crotonase                               
   1::258  6.2e-83 48.2% 0048890 00488901 1/1   crotonase                               
   2::258  3.9e-82 44.1% 0052487 00524871 1/1   crotonase                               
   1::258  4.4e-81 46.7% 0036954 00369541 1/1   crotonase                               
   2::257    6e-81 46.5% 0048476 00484761 1/1   crotonase                               
   1::258  1.1e-80 46.5% 0038805 00388051 1/1   crotonase                               
   3::246  3.1e-80 49.2% 0038654 00386541 1/1   crotonase                               
   6::255  4.1e-80 48.2% 0044384 00443841 1/1   crotonase                               
   4::255    2e-79 48.6% 0050758 00507581 1/1   crotonase                               
   1::252  4.8e-79 47.0% 0051137 00511371 1/1   crotonase                               
   2::242  1.2e-78 45.6% 0052608 00526081 1/1   crotonase                               
   1::259  1.8e-76 49.4% 0049386 00493861 1/1   crotonase                               
   4::239  7.2e-76 45.8% 0048518 00485181 1/1   crotonase                               
   5::232  9.9e-68 45.8% 0051719 00517191 1/1   crotonase                               
  84::201  1.6e-16 31.4% 0041933 00419331 1/1   crotonase                               
   2::184  1.7e-16 32.9% 0052142 00521421 1/1   crotonase                               
  81::199  4.4e-15 22.7% 0041934 00419341 1/1   crotonase                               
   4::185  6.7e-15 34.0% 0044160 00441601 1/1   crotonase                               
  84::214  2.9e-14 22.9% 0051041 00510411 1/1   crotonase                               
  88::184    1e-11 33.0% 0051228 00512281 1/1   crotonase                               
  88::185  5.5e-10 29.6% 0049617 00496171 1/1   crotonase                               
  89::191  2.4e-08 28.2% 0052604 00526041 1/1   crotonase                               
   1::258


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPENVIIVEREGRVGIVTLNRPEVLNALNDELMDALGAALLAFDADDGIGAIVIAGTARAFAAGADIAGM
00504441   1/1  mmmsyetvlvevledgvatitlnrpdeklNalslemlaeLaealdeleadddvrvvvltgagkaFcaGaD
00527931   1/1  -lselilveveggvatitlnrpeklNalslemlaelaealdele.dddvrvvvltgagkaFcaGaDlkel
00463001   1/1  lsyelilveveggvatitLnrPeklNalslemlaelaealdeleadddvrvvvltGagkaFcaGaDlkel
00488901   1/1  llllllllllllllllmsyetvlveveggvatitlnrPeklNalslemlaelaaaldaleadddvrvvvl
00524871   1/1  -syetvlvevdgggslvatitlnrpeklNalslemlrellealdeleadddvrvvvltgagkaFcaGaDl
00369541   1/1  lsyelvlvevdggvavitLnrpeklNalslemlaelaealdale.dddvrvvvltgagpgkaFcaGaDlk
00484761   1/1  -lyelilveveggvatitlnrPeklNalslemlaelaealdeleadddvrvvvltGagkaFcaGaDlkel
00388051   1/1  mlmeyelvlvevdggvavitlnrpeklNalslemleellealdeaeadddvrvvvltgagpkaFcaGaDl
00386541   1/1  --yelvlveveggvavitLnrPeklNalnlemlaeLaealdeaeadddvrvvvltGagraFcaGaDlkel
00443841   1/1  -----vlveveggvavitlnrpeklnalslemleellealdeaeadddvrvvvltgagkaFcaGaDlkel
00507581   1/1  ---llllleelelilveveggvatitlnrPeklNalslemlaeladaldeleadddvrvvvltGagkaFc
00511371   1/1  llmsyetilvevdggvatltlnrpe.lNalslemlaelldaldaleadddvrvvvltgagdkaFcaGaDl
00526081   1/1  -eyetvlvevdggvatitlnrpeklNalslemlaelaealdaleadd.vrvvvltGagkaFcaGaDlkel
00493861   1/1  msyelvlvevdggvatitlnrpe.lNalslemlaellaaldaleadddvrvvvltgagdkaFcaGaDlke
00485181   1/1  ---llllllaaleeletilveveggvatitlnrpeklNalslemlaelaealdeleadddvrvvvltGag
00517191   1/1  ----lvlleveggvatitlnrpeklNalslemlaeladaldaleadddvrvvvltgagdkaFcaGaDlke
00419331   1/1  ----------------------------------------------------------------------
00521421   1/1  -lllldlysrllkvaviflggp.....ivdgsaelivaallaaeaddsvkgivlyinspGgsvtaglaiy
00419341   1/1  ----------------------------------------------------------------------
00441601   1/1  ---lldiysrllkvaviflsgp.....ivdgladdvvaallaaeaddpvkgivl....yinspGGsvtag
00510411   1/1  ----------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00496171   1/1  ----------------------------------------------------------------------
00526041   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPG
00504441   1/1  lkelaeladgdaeelleflrllqrllraletlpkPviAavnGaalGgGlelalacdlriaaedakfglpe
00527931   1/1  aellaagllelllallrlllelllallnlpkPviAavnGaAlGgGlelalacDlriasedakfglpevkl
00463001   1/1  aellaagaalllallldlllallrlllrlllalrdlpkPviAavnGaalGgGlelalacdlriasedakf
00488901   1/1  tGagdsekeglkaFcaGaDlkelaallglllglslaldaelllallrlllrllralrdlpkPviAavnGa
00524871   1/1  kelgdaeellallrllq.dlllalltlpkPviAavnGaalGgGlelalacdlriasedakfglpevklGl
00369541   1/1  elagdaeellallrllqrlllalltlpkPviAavnGaalGgGlelalacdlrvaaedakfglpevklGli
00484761   1/1  aellaagldlelllallrlllrlllallnlpkPviAavnGaalGgGlelalacDlriasedakfglpevk
00388051   1/1  kelaagdaaelralvralqrllralltlpkPviAavnGlalGgGlelalacDlrvaaedakfglpevklG
00386541   1/1  adllaadaagalalllalllalarlllelllallrlpkPviAavnGaAlGgGlelalacDlriaaeedAk
00443841   1/1  adlpggdaaelralaralarlllalltlpkPviAavnGaalGgGlelalacdlrvaaedarfglpevklG
00507581   1/1  aGaDlkelaelladlelllallrlllrlllalldlpkPviAavnGaAlGgGlelalacDlriasedakfg
00511371   1/1  kelaagdaeellallralqrlllalltlpkPviAavnGaalGgGlelalacdlrvaaedakfslglpevk
00526081   1/1  aallaagdaeellallrlllrlllalltlpkPviAavnGaalGgGlelalacdlriaaedakfglpevkl
00493861   1/1  laaldaeellallrllarlllalltlpkPviAavnGaalGgGlelalacdlriaaedakfllglpevklG
00485181   1/1  kaFcaGaDlkelasllaeellallrlllrlllallnlpkPviAavnGaAlGgGlelalacDlriasedak
00517191   1/1  laalgdaelllallrllqrlllalltlpkPviAavnGaalGgGlelalacdlriaaedakfglpevklGl
00419331   1/1  -------------ifralarlsg.gvPviavvtgpayGGgaylaalgdfviavpnArigvagpev.....
00521421   1/1  da....................lralkkpvvayvlglaasagyylalaadkgkiyalpnarvgihgplgg
00419341   1/1  ----------agaiakllaalseagvPviavvlgpayGGgayamasralladfvialpnarigvmgpeva
00441601   1/1  ..............laiydalrrlkkpvvaivlglaasagyllalaadkgkivalpnarvgihgpiggal
00510411   1/1  -------------gakllaalaelgvPvisvvtgpayGggayamasralladfviawpnarigvmgpeva
00512281   1/1  -----------------ydalralkkpvvaivlglaaSagylialaadkgkiyalpnarvgihgpeggar
00496171   1/1  -----------------ydalrrlkkpvvtivlglaaSagyliaaagdkgkryalpnarvgihgplggas
00526041   1/1  ------------------dtlksikapvvtivlglAaSaaslillagdkgkrfalpnarimihqpsggal


                         +         -         -         -         -         *         -:210
query           AGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE
00504441   1/1  vklGlvpgaggtqrlprlvglaralellltgrrlsaeeAlelGlvdevvpadellaaalalaeelaalsp
00527931   1/1  GlvpgaggtvrlprlvglaralellltgrrisaeeAlelGlvnevvpdeelleaalelaeelaslsplal
00463001   1/1  glpevklGlvpdvggtqrlprlvgelsralellltgrridAeeAlelGlvnevvpddelllaaalelaee
00488901   1/1  AlGgGlelalacdlriaaeddakfglpevklGlvpgaggtqrlprlvGlarAlellltgrridAeeAlel
00524871   1/1  vpggggtvrlprlvglsralellltgrrisaeeAlelGlvdevvpddellaaalelaeelaslsplalra
00369541   1/1  pgaggtqrlprlvglaralellltgrrlsAeealelGlvdevvpadelleaalelaeelaalsplalrat
00484761   1/1  lGlvpgaggtvrlprlvglaralellltgrridAeeAlelGlvnevvpdeellaealelaeeiaalspla
00388051   1/1  lvpggggtqrlprlvglaralellltgrrisaeealelGlvdevvpadellaalkelalelaerlaalsp
00386541   1/1  fglpevklGlvpgaggtqrlprlvglsrAlellltgrrldaeeAlrlGlvnrvvpddellaealalelll
00443841   1/1  lvpg.ggtarlprlvglaralellltgrrlsaeealelGlvdevvpadelleaalelaeelaalsplalr
00507581   1/1  lpevklGlvpgaggtqrlprlvGlaralellltgrridAeeAlelGLvnrvvpddelleealelaeriaa
00511371   1/1  lGlvpgaggtqrlprlvglaralellltgrrlsAeeAlelGlvdevvpadellaaalalaeelaalspla
00526081   1/1  GlvpgaggtqrlprlvglaralellltgrrldaeeAlelGlvdevvpaeellaaalelaeelaalsplal
00493861   1/1  lvpgaggtqrlprlvglaralellltgrrldAeeAlelGlvdevvpddellaaalelaeelaalsplala
00485181   1/1  fglpevklGlvpgaggtvrlprlvglaralellltgrridAeeAlelGlvnevvpdeelleealelaeei
00517191   1/1  vpg.ggtqrlprlvglaralellltgrrldaeeAlelGlvdevvpddellaaalelaeelaalsplalaa
00419331   1/1  ......iaailgekvaaeell....gtaehalesGvvdlvvppdelrlelarllllllnks---------
00521421   1/1  algsaedleilaelldklyerflelvaegrglslekiekladrd--------------------------
00419341   1/1  aailgrdelrlaeaaealraaliavlteelggaevalelglvddvidpaearavlrral-----------
00441601   1/1  gsaedieilaelldklyelfvelvaegrglslekleeladrdtwl-------------------------
00510411   1/1  agilgedelealggaevhalsgvalllaedfataeellelglvdgvidppdlrevlsrllslllelplee
00512281   1/1  gdlsaedreilaalldklyerfielvaegrglslekveeladrg--------------------------
00496171   1/1  gqaedieilaelllklrerfieivaerrglsleeiekladrdtwl-------------------------
00526041   1/1  gqasdieilaeellklkerlveiyaektglslekieklmdrdtwltaeeAl-------------------


                         -         -         -         +         -         -         -:280
query           SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVHR----------------------
00504441   1/1  lalratkrllrraldlslaealalelalfalllasedflegvraflek----------------------
00527931   1/1  aatKrllnaaldlsleealeleaallallllsedakegvaaflek-------------------------
00463001   1/1  iaslsplalratkrllnaaldlsleealeleaallallllsedakeg-----------------------
00488901   1/1  Glvnrvvpadellaaalelaerlaaksplalratkrllnaaldlslee----------------------
00524871   1/1  tkrllraalelsleealeleaallallfasedakegvaaflekrkpvf----------------------
00369541   1/1  krllraalelsleeallleleaalfalllasedakegvraflekrkPv----------------------
00484761   1/1  lratkrllnaaldlsleealeleaallallllsedakegvaaflekr-----------------------
00388051   1/1  lalratkrllrralelsleealelelelfalllaspdaqegvraflek----------------------
00386541   1/1  elaeelaalsplalratkrllnralelsleealele----------------------------------
00443841   1/1  atkellrralelsleealelelalfalllaspdaqegvraflekr-------------------------
00507581   1/1  lpplalratKrllnaaldlsl.ealeleaallallllsedakegv-------------------------
00511371   1/1  laatkrllraalelsleealeleaalfallllsedakegvra----------------------------
00526081   1/1  ratkrllrraldlsleealelearlfalllas--------------------------------------
00493861   1/1  atkrllrraldlsleeal.............edalegvraflekrkPkf---------------------
00485181   1/1  aslsplalratKrllnaaldlsleealel-----------------------------------------
00517191   1/1  tkrllraaldlsleealelear------------------------------------------------
00419331   1/1  ----------------------------------------------------------------------
00521421   1/1  ----------------------------------------------------------------------
00419341   1/1  ----------------------------------------------------------------------
00441601   1/1  ----------------------------------------------------------------------
00510411   1/1  llkk------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00496171   1/1  ----------------------------------------------------------------------
00526041   1/1  ----------------------------------------------------------------------