[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE38828.1


[Show Plain Result]

## Summary of Sequence Search
   1::372
   7::372  3.3e-81 30.3% 0049768 00497681 1/1   MetE-like                               
   8::371    1e-77 31.0% 0049767 00497671 1/1   MetE-like                               
  15::361  1.1e-25 21.1% 0047539 00475391 1/1   MetE-like                               
  32::369  1.5e-19 22.8% 0049982 00499821 1/1   MetE-like                               
   1::372


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQRTKAPFRADEVGSLLRPQSIKDARARLEKGEISAADLRRIEDMEIEKIVHKQSAIGLKLATDGEFRRS
00497681   1/1  ------eevrerlaalteellsrsspfllrallqeellnlpllptttvGsfPrprelkkareaywkgkis
00497671   1/1  -------l.tttvG.fPrpgalrelkkareaywkgeiseeellevakeaiaevvklqeeaGldvitdGef
00475391   1/1  --------------snerllralrgeevdrlPvwpmrqaGrylpeyrelrekr.......lsflelcedp
00499821   1/1  -------------------------------emmmtsnerllralrgekvdrvPvwlmrqaGrylpeyre


                         -         -         *         -         -         -         -:140
query           WWHFDFLSHLTGCELYHPDTGIQFAGVQTRNDSIRVIGKLDFPDDHPMLEHFRFLKRHADIAHVTAKMTI
00497681   1/1  feellevadeaievtvqlqeeagldvvtdGefsrsdivldfaeglggva.femtkwfqtng.pylvrpei
00497671   1/1  srydmvldtllllgaiperfapldllldldyffemlrGlvdftalemvkwfgtnyhylvPeitgdisfkl
00475391   1/1  elaaevtlqpqerfglDaailf.sdi.lvmveaf....Glkldfvegegpvingpvrsyedvkklivpdd
00499821   1/1  lrggisflelckdpelaaevtlqpqerfglDaail..fsdilvhaeal....Glrldfvegfgpvlegpl


                         +         -         -         -         -         *         -:210
query           PSPAVLHFRGGRKAISSEVYPDLDGFFEDLARTYRKAVKAFYDAGCRYLQFDDTVWAYLCSQDELQKARE
00497681   1/1  ivgdvfrld.pyvleaikllakllg...vplkgfltgPvtllallkegg.....pedreelledladayr
00497671   1/1  sllklldelkeaksl....gkpvkgvlpGPvtllals...klrndyykdlealelledlaeayreelkal
00475391   1/1  verlppvlealkllaeelg.gevplkgflggPftlaaylvegggskdfekilkdlyrdpellhelldkla
00499821   1/1  rtledleklvvpddvegrlpyvleaikllreelg.gevpligflggPftlasylveGggskdfekilkll


                         -         -         -         +         -         -         -:280
query           RGDNPDNLQQIYSRVINYAIAERPSDMVITTHVCRGNFRSTWISSGGYEPVAETLLAGINYDGYFLEYDS
00497681   1/1  eelkalieaGadvvqidEPslagllslr........lldpddylefavealnrilsgvpddlkiplhtcf
00497671   1/1  adaGarviqiDEPal...............vldlpelleealelanralsgvpddvkillhtcfgnlegd
00475391   1/1  dalieylkalieaGadviqiddpalgvlspe...........dylefalpalkriveglkdlp.gtliil
00499821   1/1  yrdpellhelldkladalieylkalieaGadaiqiddpwaglls..............pedylefalpyl


                         -         *         -         -         -         -         +:350
query           ERAGGFEPLRFLPKGNKVVVVGVITSKFGELEKKDDIKRRLDEAAKFAPLAQLALSPQCGFASTEEGNIL
00497681   1/1  gnf..........gdilella.dlgvdvlsldlvrsraglldalkellpsgkvlvlGvvdprnlwledle
00497671   1/1  il..........dllldlpnvdglslelvrsragllevleklpkg.kvlvlGvvdgrnpwledleeilar
00475391   1/1  hfc.gga..........gpilellae.lgvdvlsldls...rdlaellellg..dkvvllGnvdprll.v
00499821   1/1  krivdgvkdllpglglegvpiilhic.g...........agpile.alaelgadvisldws...vdlaea


                         -         -         -         -         *         -         -:420
query           SEQEQWDKLRLAVEVAQDVWGR------------------------------------------------
00497681   1/1  eilarieealeylgldrlivnp------------------------------------------------
00497671   1/1  ieealeylglerlivspdCgl-------------------------------------------------
00475391   1/1  gspeeilelvk-----------------------------------------------------------
00499821   1/1  lellgd..kvvlqGnld.p---------------------------------------------------