[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39200.1


[Show Plain Result]

## Summary of Sequence Search
   1::95
   3::92     1e-17 33.7% 0040970 00409701 1/1   IG endonuclease                         
   1::95


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSILEARTREHVLK
00409701   1/1  --nkpgvYlitnkangklYvGkakdLkkRlssyfnglgagftktrllvrailkygenfvllileevtdse


                         -         -         *         -         -         -         -:140
query           RWRRDWKIALIEKLNPDWRDLSNDL---------------------------------------------
00409701   1/1  lealllEnylikllrpr....i------------------------------------------------