[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39205.1


[Show Plain Result]

## Summary of Sequence Search
   1::431
 135::431  5.1e-77 41.8% 0048568 00485681 1/1    capsid protein gp5                     
   1::431


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNPFFIITTRDHMMTTTFDHAPETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEKRGGDVIAEDK
00485681   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VARIDAALNAQQRRLDELALKQARPQLGADSALRPRGAAEHKSAFDAYIRNGDAATLRQIETKALSVGSN
00485681   1/1  ----------------------------------------------------------------lstgtt


                         +         -         -         -         -         *         -:210
query           PDGGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYKKPFMTAGPATGWVGEAAARPQTSSPTLDAL
00485681   1/1  gdggylvpeelsdeiiellrevsvlrdlatvvptsggsleypretgdggnagwvgEggakpesd.ptfdk


                         -         -         -         +         -         -         -:280
query           SFPAMELYAMPAATATLLDDAAVNLDDWLTGEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSW
00485681   1/1  vtlklkklaalikisnelldds.vdlesyvadrlaealaraedaailnGdGtgkpltGiltaagaatvta


                         -         *         -         -         -         -         +:350
query           GNLGFVATGAAGAFPASNPSDVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASG
00485681   1/1  tv..............agaitaddlvdaiysldaayrdnavlvmnpatlaalrklkdadGrylwqppl.g


                         -         -         -         -         *         -         -:420
query           RASLIGFPLADAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF
00485681   1/1  gapgtllGlPvviseampag.....kilfgdfsdayligdrggvtversteadkdflknqvlfraeerlg


                         -         -         +         -         -         -         -:490
query           DAIKLLKFGGS-----------------------------------------------------------
00485681   1/1  gavvdpeafvl-----------------------------------------------------------