[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39246.1


[Show Plain Result]

## Summary of Sequence Search
   1::526
  30::325  3.4e-64 46.3% 0049034 00490341 1/1   in-like serine proteases                
  70::308    2e-62 43.4% 0040351 00403511 1/1   in-like serine proteases                
  70::312  4.5e-62 47.1% 0043683 00436831 1/1   in-like serine proteases                
 136::337  1.1e-61 46.1% 0048877 00488771 1/1   in-like serine proteases                
  76::318  1.3e-56 50.0% 0041537 00415371 1/1   in-like serine proteases                
  71::311  1.2e-55 39.5% 0047907 00479071 1/1   in-like serine proteases                
 140::349    2e-54 52.8% 0048133 00481331 1/1   in-like serine proteases                
  25::308  3.1e-54 48.4% 0035042 00350421 1/1   in-like serine proteases                
 124::310  1.5e-53 41.1% 0049010 00490101 1/1   in-like serine proteases                
  65::313  4.1e-51 43.6% 0043039 00430391 1/1   in-like serine proteases                
 135::312  4.4e-51 41.6% 0051243 00512431 1/1   in-like serine proteases                
 157::315  5.6e-48 51.3% 0036154 00361541 1/1   in-like serine proteases                
 127::308  8.8e-46 40.2% 0053299 00532991 1/1   in-like serine proteases                
  69::313  3.9e-45 50.0% 0035500 00355001 1/1   in-like serine proteases                
  65::304    1e-42 31.6% 0047957 00479571 1/1   in-like serine proteases                
 127::308  1.5e-40 47.4% 0052737 00527371 1/1   in-like serine proteases                
 126::308    1e-39 38.2% 0053300 00533001 1/1   in-like serine proteases                
 126::308    3e-39 37.8% 0047218 00472181 1/1   in-like serine proteases                
 133::312  1.6e-37 42.6% 0050139 00501391 1/1   in-like serine proteases                
 126::308  2.9e-37 34.7% 0043603 00436031 1/1   in-like serine proteases                
 120::308  3.7e-33 29.0% 0042134 00421341 1/1   in-like serine proteases                
 314::410  1.9e-28 46.8% 0040455 00404551 1/2   omain-like                              
 273::399  7.2e-27 39.2% 0043410 00434101 1/2   omain-like                              
 283::414  2.7e-26 40.0% 0044311 00443111 1/2   omain-like                              
 286::410  1.2e-25 39.1% 0050057 00500571 1/2   omain-like                              
 313::411  2.8e-25 41.4% 0043682 00436821 1/2   omain-like                              
 140::329  3.7e-25 27.4% 0035182 00351821 1/1   in-like serine proteases                
 312::405  1.4e-24 38.3% 0040317 00403171 1/2   omain-like                              
 279::397  3.6e-24 36.8% 0041357 00413571 1/2   omain-like                              
 113::310  6.5e-24 28.8% 0038512 00385121 1/1   in-like serine proteases                
 313::410  6.9e-24 44.3% 0051242 00512421 1/2   omain-like                              
 314::403  2.6e-23 44.3% 0040319 00403191 1/2   omain-like                              
 266::418  7.3e-23 42.0% 0045940 00459401 1/2   omain-like                              
 286::402  2.1e-22 38.0% 0050553 00505531 1/2   omain-like                              
 286::401  2.2e-22 39.4% 0050572 00505721 1/2   omain-like                              
 303::397  2.9e-22 42.4% 0052650 00526501 1/2   omain-like                              
 269::404  3.3e-22 38.5% 0050550 00505501 1/2   omain-like                              
 268::414  1.5e-21 37.0% 0045904 00459041 1/2   omain-like                              
 290::408  2.1e-21 37.8% 0049876 00498761 1/2   omain-like                              
 287::421  2.9e-21 33.3% 0044315 00443151 1/2   omain-like                              
 293::403  6.2e-21 37.5% 0044366 00443661 1/2   omain-like                              
 138::295  6.6e-21 34.8% 0040353 00403531 1/1   in-like serine proteases                
 271::399  7.3e-21 39.2% 0042601 00426011 1/2   omain-like                              
 293::396  7.4e-21 39.2% 0050835 00508351 1/2   omain-like                              
 292::403  1.5e-20 39.0% 0048900 00489001 1/2   omain-like                              
 301::396  4.6e-20 35.5% 0039028 00390281 1/2   omain-like                              
 280::397  6.8e-20 39.6% 0051643 00516431 1/2   omain-like                              
 274::412  1.2e-19 40.8% 0050486 00504861 1/2   omain-like                              
 136::300  1.3e-19 33.5% 0036116 00361161 1/1   in-like serine proteases                
 268::411  3.5e-19 41.3% 0049946 00499461 1/2   omain-like                              
 284::410  4.2e-19 44.4% 0037485 00374851 1/2   omain-like                              
 273::402  5.4e-19 36.2% 0044688 00446881 1/2   omain-like                              
 286::405  1.9e-18 35.1% 0044391 00443911 1/2   omain-like                              
 252::405  7.8e-18 33.0% 0050584 00505841 1/2   omain-like                              
 267::404  1.2e-17 35.3% 0050507 00505071 1/2   omain-like                              
 301::405  1.6e-17 32.6% 0042269 00422691 1/2   omain-like                              
 270::397  2.6e-17 42.9% 0040806 00408061 1/2   omain-like                              
 301::399  3.2e-17 34.4% 0038159 00381591 1/2   omain-like                              
 268::405  6.3e-17 36.4% 0049878 00498781 1/2   omain-like                              
 294::406    8e-17 37.4% 0050833 00508331 1/2   omain-like                              
 300::402  1.8e-16 31.9% 0038015 00380151 1/2   omain-like                              
 315::406  1.8e-16 33.3% 0047731 00477311 1/2   omain-like                              
 271::396    3e-16 37.8% 0050618 00506181 1/2   omain-like                              
 315::397  5.4e-16 37.8% 0041555 00415551 1/2   omain-like                              
 275::411  9.6e-16 41.3% 0049781 00497811 1/2   omain-like                              
 295::404  1.1e-15 30.6% 0044398 00443981 1/2   omain-like                              
 143::311  1.3e-15 25.2% 0035283 00352831 1/1   in-like serine proteases                
 337::412  1.3e-15 39.5% 0044623 00446231 1/2   omain-like                              
 292::404  2.5e-15 33.3% 0052281 00522811 1/2   omain-like                              
 303::398  3.5e-15 36.6% 0050487 00504871 1/2   omain-like                              
 291::398  3.8e-15 34.4% 0050836 00508361 1/2   omain-like                              
 303::398  3.9e-15 37.0% 0041775 00417751 1/2   omain-like                              
 303::403  4.1e-15 38.0% 0040399 00403991 1/2   omain-like                              
 275::399  1.2e-14 34.8% 0040042 00400421 1/2   omain-like                              
 302::398  1.6e-14 30.8% 0049521 00495211 1/2   omain-like                              
 305::397  5.1e-14 36.0% 0049780 00497801 1/2   omain-like                              
 432::526  5.3e-14 37.6% 0051242 00512422 2/2   omain-like                              
 291::408  5.9e-14 32.4% 0052270 00522701 1/2   omain-like                              
 281::396  8.3e-14 29.9% 0050114 00501141 1/2   omain-like                              
 433::526  8.5e-14 32.6% 0040455 00404552 2/2   omain-like                              
 261::412    9e-14 32.1% 0050063 00500631 1/2   omain-like                              
 332::413  1.1e-13 37.5% 0050116 00501161 1/2   omain-like                              
 300::398    2e-13 29.7% 0052663 00526631 1/2   omain-like                              
 291::402  2.1e-13 33.0% 0044399 00443991 1/2   omain-like                              
 295::397  2.3e-13 35.6% 0042687 00426871 1/2   omain-like                              
 431::521  3.1e-13 34.9% 0040317 00403172 2/2   omain-like                              
 306::403  3.3e-13 31.9% 0048138 00481381 1/2   omain-like                              
 432::527  4.8e-13 35.1% 0043682 00436822 2/2   omain-like                              
 275::399  5.2e-13 35.9% 0051603 00516031 1/2   omain-like                              
 428::519  6.9e-13 35.2% 0040319 00403192 2/2   omain-like                              
 138::308  7.1e-13 21.4% 0045318 00453181 1/1   in-like serine proteases                
 273::406  2.1e-12 29.3% 0038828 00388281 1/2   omain-like                              
 292::406  4.3e-12 32.0% 0044310 00443101 1/2   omain-like                              
 436::522  5.2e-12 37.5% 0050833 00508332 2/2   omain-like                              
 303::395  5.6e-12 35.4% 0052727 00527271 1/2   omain-like                              
 297::404  9.3e-12 35.9% 0041243 00412431 1/2   omain-like                              
 290::398  9.5e-12 31.0% 0041246 00412461 1/2   omain-like                              
 434::526  1.6e-11 29.2% 0050057 00500572 2/2   omain-like                              
 273::399    2e-11 32.6% 0042844 00428441 1/2   omain-like                              
 273::397  2.1e-11 27.2% 0050516 00505161 1/2   omain-like                              
 293::408  2.4e-11 32.0% 0044337 00443371 1/2   omain-like                              
 407::518  2.9e-11 27.0% 0050553 00505532 2/2   omain-like                              
 417::520  3.9e-11 25.5% 0050550 00505502 2/2   omain-like                              
 339::402  6.7e-11 41.3% 0050492 00504921 1/2   omain-like                              
 275::398  7.9e-11 37.1% 0052077 00520771 1/2   omain-like                              
 136::307  9.9e-11 20.7% 0040858 00408581 1/1   in-like serine proteases                
 436::524  9.9e-11 33.7% 0044311 00443112 2/2   omain-like                              
 430::526  1.1e-10 33.3% 0037485 00374852 2/2   omain-like                              
 436::524  1.1e-10 34.1% 0049876 00498762 2/2   omain-like                              
 414::524  1.3e-10 30.8% 0049946 00499462 2/2   omain-like                              
 434::519  1.3e-10 35.4% 0044366 00443662 2/2   omain-like                              
 432::518  1.4e-10 33.8% 0038015 00380152 2/2   omain-like                              
 266::398  1.6e-10 33.3% 0042116 00421161 1/2   omain-like                              
 292::409  1.6e-10 34.6% 0050857 00508571 1/2   omain-like                              
 407::517    2e-10 26.9% 0050572 00505722 2/2   omain-like                              
 328::398  2.1e-10 32.4% 0050541 00505411 1/2   omain-like                              
 414::521  2.4e-10 28.7% 0049878 00498782 2/2   omain-like                              
 451::528  3.3e-10 32.9% 0044623 00446232 2/2   omain-like                              
 434::522  3.4e-10 32.9% 0045904 00459042 2/2   omain-like                              
 432::514  3.6e-10 36.7% 0050836 00508362 2/2   omain-like                              
 436::515  5.6e-10 31.6% 0043410 00434102 2/2   omain-like                              
 434::521  6.6e-10 32.1% 0042269 00422692 2/2   omain-like                              
 412::521  7.1e-10 29.7% 0050584 00505842 2/2   omain-like                              
 432::518  7.4e-10 32.5% 0044688 00446882 2/2   omain-like                              
 432::513  8.8e-10 35.0% 0052650 00526502 2/2   omain-like                              
 143::307  8.9e-10 22.1% 0038059 00380591 1/1   in-like serine proteases                
 436::524  9.8e-10 35.0% 0045940 00459402 2/2   omain-like                              
 313::396  1.1e-09 31.6% 0044638 00446381 1/2   omain-like                              
 426::522  1.1e-09 33.0% 0044315 00443152 2/2   omain-like                              
 435::520  1.1e-09 33.3% 0052281 00522812 2/2   omain-like                              
 318::398  1.3e-09 35.4% 0040294 00402941 1/2   omain-like                              
 436::513  1.3e-09 33.8% 0041357 00413572 2/2   omain-like                              
 432::514  1.6e-09 37.8% 0041775 00417752 2/2   omain-like                              
 432::514  1.7e-09 36.2% 0049521 00495212 2/2   omain-like                              
 435::527  2.2e-09 37.3% 0049781 00497812 2/2   omain-like                              
 436::513  2.6e-09 39.2% 0042601 00426012 2/2   omain-like                              
 328::397  3.4e-09 39.7% 0050574 00505741 1/2   omain-like                              
 436::523  3.4e-09 38.4% 0050116 00501162 2/2   omain-like                              
 434::519  3.5e-09 35.4% 0048900 00489002 2/2   omain-like                              
 436::526  3.5e-09 27.9% 0038828 00388282 2/2   omain-like                              
 436::521    4e-09 30.5% 0044391 00443912 2/2   omain-like                              
 436::523  4.2e-09 34.6% 0050063 00500632 2/2   omain-like                              
 422::519  5.5e-09 28.7% 0040399 00403992 2/2   omain-like                              
 436::525  5.5e-09 28.9% 0050857 00508572 2/2   omain-like                              
 425::518  6.2e-09 31.5% 0048138 00481382 2/2   omain-like                              
 434::525  6.6e-09 35.4% 0047731 00477312 2/2   omain-like                              
 436::515  7.8e-09 35.1% 0038159 00381592 2/2   omain-like                              
 429::513  8.3e-09 34.9% 0040806 00408062 2/2   omain-like                              
 436::522  8.5e-09 31.6% 0044310 00443102 2/2   omain-like                              
 436::524  8.6e-09 32.5% 0052270 00522702 2/2   omain-like                              
 436::514  9.3e-09 31.6% 0050516 00505162 2/2   omain-like                              
 436::512  9.7e-09 30.7% 0050541 00505412 2/2   omain-like                              
 432::512  9.8e-09 36.7% 0039028 00390282 2/2   omain-like                              
 436::513  1.3e-08 35.6% 0051643 00516432 2/2   omain-like                              
 421::514  1.5e-08 28.9% 0040042 00400422 2/2   omain-like                              
 436::520  1.6e-08 35.4% 0050507 00505072 2/2   omain-like                              
 436::514  2.1e-08 33.8% 0050487 00504872 2/2   omain-like                              
 434::511  2.3e-08 31.2% 0050835 00508352 2/2   omain-like                              
 432::512  2.7e-08 38.6% 0050114 00501142 2/2   omain-like                              
 436::524  2.8e-08 31.7% 0044337 00443372 2/2   omain-like                              
 424::513  3.4e-08 32.6% 0049780 00497802 2/2   omain-like                              
 436::514    4e-08 32.4% 0041246 00412462 2/2   omain-like                              
 337::397  4.4e-08 36.1% 0049948 00499481 1/2   omain-like                              
 436::520  4.4e-08 29.6% 0044398 00443982 2/2   omain-like                              
 436::518  4.4e-08 36.1% 0044399 00443992 2/2   omain-like                              
 453::524  5.4e-08 35.7% 0050486 00504862 2/2   omain-like                              
 435::512  9.3e-08 28.0% 0044638 00446382 2/2   omain-like                              
 430::512  1.3e-07 35.8% 0050618 00506182 2/2   omain-like                              
 436::520  1.4e-07 33.8% 0041243 00412432 2/2   omain-like                              
 436::513  1.7e-07 41.5% 0041555 00415552 2/2   omain-like                              
 436::513  1.7e-07 40.0% 0042687 00426872 2/2   omain-like                              
 436::514  2.7e-07 35.1% 0052663 00526632 2/2   omain-like                              
 436::514  2.9e-07 34.2% 0042116 00421162 2/2   omain-like                              
 436::526  4.5e-07 30.6% 0049948 00499482 2/2   omain-like                              
 421::514  5.2e-07 27.8% 0051603 00516032 2/2   omain-like                              
 436::517  5.8e-07 30.4% 0050492 00504922 2/2   omain-like                              
 436::515  1.2e-06 33.8% 0050574 00505742 2/2   omain-like                              
 436::511  1.8e-06 33.8% 0052727 00527272 2/2   omain-like                              
 436::514  2.7e-06 34.7% 0052077 00520772 2/2   omain-like                              
 138::308  3.3e-06 20.8% 0037840 00378401 1/1   in-like serine proteases                
 436::514  4.5e-06 36.0% 0042844 00428442 2/2   omain-like                              
 422::514  4.9e-06 26.5% 0040294 00402942 2/2   omain-like                              
 138::308  8.5e-06 18.1% 0037786 00377861 1/1   in-like serine proteases                
 143::309  1.7e-05 20.2% 0037131 00371311 1/1   in-like serine proteases                
 142::308  0.00019 19.1% 0042416 00424161 1/1   in-like serine proteases                
 339::413  0.00033 31.5% 0044382 00443821 1/2   omain-like                              
 445::486  0.00039 38.1% 0044382 00443822 2/2   omain-like                              
   1::526


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDRNTDLPSQPSRQPDRRSLLSARKFALMASVVAGLGAGAFGLSQTSTPVDLFSTPAHAQVGNKVNQAQ
00490341   1/1  -----------------------------mklllllllllllllllaalg..................ad
00403511   1/1  ---------------------------------------------------------------------l
00436831   1/1  ---------------------------------------------------------------------a
00488771   1/1  ----------------------------------------------------------------------
00415371   1/1  ----------------------------------------------------------------------
00479071   1/1  ----------------------------------------------------------------------
00481331   1/1  ----------------------------------------------------------------------
00350421   1/1  ------------------------mkllllllllllllllllaasalrlplgld................
00490101   1/1  ----------------------------------------------------------------------
00430391   1/1  ----------------------------------------------------------------vllaed
00512431   1/1  ----------------------------------------------------------------------
00361541   1/1  ----------------------------------------------------------------------
00532991   1/1  ----------------------------------------------------------------------
00355001   1/1  --------------------------------------------------------------------ld
00479571   1/1  ----------------------------------------------------------------Plllll
00527371   1/1  ----------------------------------------------------------------------
00533001   1/1  ----------------------------------------------------------------------
00472181   1/1  ----------------------------------------------------------------------
00501391   1/1  ----------------------------------------------------------------------
00436031   1/1  ----------------------------------------------------------------------
00421341   1/1  ----------------------------------------------------------------------
00404551   1/2  ----------------------------------------------------------------------
00434101   1/2  ----------------------------------------------------------------------
00443111   1/2  ----------------------------------------------------------------------
00500571   1/2  ----------------------------------------------------------------------
00436821   1/2  ----------------------------------------------------------------------
00351821   1/1  ----------------------------------------------------------------------
00403171   1/2  ----------------------------------------------------------------------
00413571   1/2  ----------------------------------------------------------------------
00385121   1/1  ----------------------------------------------------------------------
00512421   1/2  ----------------------------------------------------------------------
00403191   1/2  ----------------------------------------------------------------------
00459401   1/2  ----------------------------------------------------------------------
00505531   1/2  ----------------------------------------------------------------------
00505721   1/2  ----------------------------------------------------------------------
00526501   1/2  ----------------------------------------------------------------------
00505501   1/2  ----------------------------------------------------------------------
00459041   1/2  ----------------------------------------------------------------------
00498761   1/2  ----------------------------------------------------------------------
00443151   1/2  ----------------------------------------------------------------------
00443661   1/2  ----------------------------------------------------------------------
00403531   1/1  ----------------------------------------------------------------------
00426011   1/2  ----------------------------------------------------------------------
00508351   1/2  ----------------------------------------------------------------------
00489001   1/2  ----------------------------------------------------------------------
00390281   1/2  ----------------------------------------------------------------------
00516431   1/2  ----------------------------------------------------------------------
00504861   1/2  ----------------------------------------------------------------------
00361161   1/1  ----------------------------------------------------------------------
00499461   1/2  ----------------------------------------------------------------------
00374851   1/2  ----------------------------------------------------------------------
00446881   1/2  ----------------------------------------------------------------------
00443911   1/2  ----------------------------------------------------------------------
00505841   1/2  ----------------------------------------------------------------------
00505071   1/2  ----------------------------------------------------------------------
00422691   1/2  ----------------------------------------------------------------------
00408061   1/2  ----------------------------------------------------------------------
00381591   1/2  ----------------------------------------------------------------------
00498781   1/2  ----------------------------------------------------------------------
00508331   1/2  ----------------------------------------------------------------------
00380151   1/2  ----------------------------------------------------------------------
00477311   1/2  ----------------------------------------------------------------------
00506181   1/2  ----------------------------------------------------------------------
00415551   1/2  ----------------------------------------------------------------------
00497811   1/2  ----------------------------------------------------------------------
00443981   1/2  ----------------------------------------------------------------------
00352831   1/1  ----------------------------------------------------------------------
00446231   1/2  ----------------------------------------------------------------------
00522811   1/2  ----------------------------------------------------------------------
00504871   1/2  ----------------------------------------------------------------------
00508361   1/2  ----------------------------------------------------------------------
00417751   1/2  ----------------------------------------------------------------------
00403991   1/2  ----------------------------------------------------------------------
00400421   1/2  ----------------------------------------------------------------------
00495211   1/2  ----------------------------------------------------------------------
00497801   1/2  ----------------------------------------------------------------------
00512422   2/2  ----------------------------------------------------------------------
00522701   1/2  ----------------------------------------------------------------------
00501141   1/2  ----------------------------------------------------------------------
00404552   2/2  ----------------------------------------------------------------------
00500631   1/2  ----------------------------------------------------------------------
00501161   1/2  ----------------------------------------------------------------------
00526631   1/2  ----------------------------------------------------------------------
00443991   1/2  ----------------------------------------------------------------------
00426871   1/2  ----------------------------------------------------------------------
00403172   2/2  ----------------------------------------------------------------------
00481381   1/2  ----------------------------------------------------------------------
00436822   2/2  ----------------------------------------------------------------------
00516031   1/2  ----------------------------------------------------------------------
00403192   2/2  ----------------------------------------------------------------------
00453181   1/1  ----------------------------------------------------------------------
00388281   1/2  ----------------------------------------------------------------------
00443101   1/2  ----------------------------------------------------------------------
00508332   2/2  ----------------------------------------------------------------------
00527271   1/2  ----------------------------------------------------------------------
00412431   1/2  ----------------------------------------------------------------------
00412461   1/2  ----------------------------------------------------------------------
00500572   2/2  ----------------------------------------------------------------------
00428441   1/2  ----------------------------------------------------------------------
00505161   1/2  ----------------------------------------------------------------------
00443371   1/2  ----------------------------------------------------------------------
00505532   2/2  ----------------------------------------------------------------------
00505502   2/2  ----------------------------------------------------------------------
00504921   1/2  ----------------------------------------------------------------------
00520771   1/2  ----------------------------------------------------------------------
00408581   1/1  ----------------------------------------------------------------------
00443112   2/2  ----------------------------------------------------------------------
00374852   2/2  ----------------------------------------------------------------------
00498762   2/2  ----------------------------------------------------------------------
00499462   2/2  ----------------------------------------------------------------------
00443662   2/2  ----------------------------------------------------------------------
00380152   2/2  ----------------------------------------------------------------------
00421161   1/2  ----------------------------------------------------------------------
00508571   1/2  ----------------------------------------------------------------------
00505722   2/2  ----------------------------------------------------------------------
00505411   1/2  ----------------------------------------------------------------------
00498782   2/2  ----------------------------------------------------------------------
00446232   2/2  ----------------------------------------------------------------------
00459042   2/2  ----------------------------------------------------------------------
00508362   2/2  ----------------------------------------------------------------------
00434102   2/2  ----------------------------------------------------------------------
00422692   2/2  ----------------------------------------------------------------------
00505842   2/2  ----------------------------------------------------------------------
00446882   2/2  ----------------------------------------------------------------------
00526502   2/2  ----------------------------------------------------------------------
00380591   1/1  ----------------------------------------------------------------------
00459402   2/2  ----------------------------------------------------------------------
00446381   1/2  ----------------------------------------------------------------------
00443152   2/2  ----------------------------------------------------------------------
00522812   2/2  ----------------------------------------------------------------------
00402941   1/2  ----------------------------------------------------------------------
00413572   2/2  ----------------------------------------------------------------------
00417752   2/2  ----------------------------------------------------------------------
00495212   2/2  ----------------------------------------------------------------------
00497812   2/2  ----------------------------------------------------------------------
00426012   2/2  ----------------------------------------------------------------------
00505741   1/2  ----------------------------------------------------------------------
00501162   2/2  ----------------------------------------------------------------------
00489002   2/2  ----------------------------------------------------------------------
00388282   2/2  ----------------------------------------------------------------------
00443912   2/2  ----------------------------------------------------------------------
00500632   2/2  ----------------------------------------------------------------------
00403992   2/2  ----------------------------------------------------------------------
00508572   2/2  ----------------------------------------------------------------------
00481382   2/2  ----------------------------------------------------------------------
00477312   2/2  ----------------------------------------------------------------------
00381592   2/2  ----------------------------------------------------------------------
00408062   2/2  ----------------------------------------------------------------------
00443102   2/2  ----------------------------------------------------------------------
00522702   2/2  ----------------------------------------------------------------------
00505162   2/2  ----------------------------------------------------------------------
00505412   2/2  ----------------------------------------------------------------------
00390282   2/2  ----------------------------------------------------------------------
00516432   2/2  ----------------------------------------------------------------------
00400422   2/2  ----------------------------------------------------------------------
00505072   2/2  ----------------------------------------------------------------------
00504872   2/2  ----------------------------------------------------------------------
00508352   2/2  ----------------------------------------------------------------------
00501142   2/2  ----------------------------------------------------------------------
00443372   2/2  ----------------------------------------------------------------------
00497802   2/2  ----------------------------------------------------------------------
00412462   2/2  ----------------------------------------------------------------------
00499481   1/2  ----------------------------------------------------------------------
00443982   2/2  ----------------------------------------------------------------------
00443992   2/2  ----------------------------------------------------------------------
00504862   2/2  ----------------------------------------------------------------------
00446382   2/2  ----------------------------------------------------------------------
00506182   2/2  ----------------------------------------------------------------------
00412432   2/2  ----------------------------------------------------------------------
00415552   2/2  ----------------------------------------------------------------------
00426872   2/2  ----------------------------------------------------------------------
00526632   2/2  ----------------------------------------------------------------------
00421162   2/2  ----------------------------------------------------------------------
00499482   2/2  ----------------------------------------------------------------------
00516032   2/2  ----------------------------------------------------------------------
00504922   2/2  ----------------------------------------------------------------------
00505742   2/2  ----------------------------------------------------------------------
00527272   2/2  ----------------------------------------------------------------------
00520772   2/2  ----------------------------------------------------------------------
00378401   1/1  ----------------------------------------------------------------------
00428442   2/2  ----------------------------------------------------------------------
00402942   2/2  ----------------------------------------------------------------------
00377861   1/1  ----------------------------------------------------------------------
00371311   1/1  ----------------------------------------------------------------------
00424161   1/1  ----------------------------------------------------------------------
00443821   1/2  ----------------------------------------------------------------------
00443822   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QPVGFADIVEKVKPSVISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFRRFGGEMPPGMRGHRGGGTMT
00490341   1/1  lrvsvadlvekalpavvrilv...dg...........................................s
00403511   1/1  glldladlvekalpavvsistlstvd.............sllarivgglvavlgsfpylvsl...vrggl
00436831   1/1  lllsladavekaspsvvgistaapvs.............................lpyq......evkgl
00488771   1/1  -----------------------------------------------------------------ivggl
00415371   1/1  -----aevvekvgpavvnivtt........................slfgrffglllgevv.....vlet
00479071   1/1  ellsfadlvekllpavvliltaglvel.............llslledllrivggvvavpgsfdlpwqvsl
00481331   1/1  ---------------------------------------------------------------------k
00350421   1/1  divggadavekpapavvsilv.......gg.......................................r
00490101   1/1  -----------------------------------------------------gelPwqvslllgggllc
00430391   1/1  rivggadavegvapsvvsllvvs...........................................gsgt
00512431   1/1  ----------------------------------------------------------------ggleea
00361541   1/1  ----------------------------------------------------------------------
00532991   1/1  --------------------------------------------------------fPyqvslll.gggl
00355001   1/1  llssvavlvekaapsvvrisvs..........................................lllggs
00479571   1/1  glllsladlverivggvvail.................................gsfpwqvslq...ggg
00527371   1/1  --------------------------------------------------------llgvyrilvigllg
00533001   1/1  -------------------------------------------------------IvgGlealigslpyq
00472181   1/1  -------------------------------------------------------ligglpyqv....gs
00501391   1/1  --------------------------------------------------------------vvlvvler
00436031   1/1  -------------------------------------------------------Ivgglealigsfp..
00421341   1/1  -------------------------------------------------rivggddllleaaigefPwqv
00404551   1/2  ----------------------------------------------------------------------
00434101   1/2  ----------------------------------------------------------------------
00443111   1/2  ----------------------------------------------------------------------
00500571   1/2  ----------------------------------------------------------------------
00436821   1/2  ----------------------------------------------------------------------
00351821   1/1  ---------------------------------------------------------------------s
00403171   1/2  ----------------------------------------------------------------------
00413571   1/2  ----------------------------------------------------------------------
00385121   1/1  ------------------------------------------vpllggapvqgnlfpiqvslls..gsrv
00512421   1/2  ----------------------------------------------------------------------
00403191   1/2  ----------------------------------------------------------------------
00459401   1/2  ----------------------------------------------------------------------
00505531   1/2  ----------------------------------------------------------------------
00505721   1/2  ----------------------------------------------------------------------
00526501   1/2  ----------------------------------------------------------------------
00505501   1/2  ----------------------------------------------------------------------
00459041   1/2  ----------------------------------------------------------------------
00498761   1/2  ----------------------------------------------------------------------
00443151   1/2  ----------------------------------------------------------------------
00443661   1/2  ----------------------------------------------------------------------
00403531   1/1  -------------------------------------------------------------------vgl
00426011   1/2  ----------------------------------------------------------------------
00508351   1/2  ----------------------------------------------------------------------
00489001   1/2  ----------------------------------------------------------------------
00390281   1/2  ----------------------------------------------------------------------
00516431   1/2  ----------------------------------------------------------------------
00504861   1/2  ----------------------------------------------------------------------
00361161   1/1  -----------------------------------------------------------------ggnea
00499461   1/2  ----------------------------------------------------------------------
00374851   1/2  ----------------------------------------------------------------------
00446881   1/2  ----------------------------------------------------------------------
00443911   1/2  ----------------------------------------------------------------------
00505841   1/2  ----------------------------------------------------------------------
00505071   1/2  ----------------------------------------------------------------------
00422691   1/2  ----------------------------------------------------------------------
00408061   1/2  ----------------------------------------------------------------------
00381591   1/2  ----------------------------------------------------------------------
00498781   1/2  ----------------------------------------------------------------------
00508331   1/2  ----------------------------------------------------------------------
00380151   1/2  ----------------------------------------------------------------------
00477311   1/2  ----------------------------------------------------------------------
00506181   1/2  ----------------------------------------------------------------------
00415551   1/2  ----------------------------------------------------------------------
00497811   1/2  ----------------------------------------------------------------------
00443981   1/2  ----------------------------------------------------------------------
00352831   1/1  ----------------------------------------------------------------------
00446231   1/2  ----------------------------------------------------------------------
00522811   1/2  ----------------------------------------------------------------------
00504871   1/2  ----------------------------------------------------------------------
00508361   1/2  ----------------------------------------------------------------------
00417751   1/2  ----------------------------------------------------------------------
00403991   1/2  ----------------------------------------------------------------------
00400421   1/2  ----------------------------------------------------------------------
00495211   1/2  ----------------------------------------------------------------------
00497801   1/2  ----------------------------------------------------------------------
00512422   2/2  ----------------------------------------------------------------------
00522701   1/2  ----------------------------------------------------------------------
00501141   1/2  ----------------------------------------------------------------------
00404552   2/2  ----------------------------------------------------------------------
00500631   1/2  ----------------------------------------------------------------------
00501161   1/2  ----------------------------------------------------------------------
00526631   1/2  ----------------------------------------------------------------------
00443991   1/2  ----------------------------------------------------------------------
00426871   1/2  ----------------------------------------------------------------------
00403172   2/2  ----------------------------------------------------------------------
00481381   1/2  ----------------------------------------------------------------------
00436822   2/2  ----------------------------------------------------------------------
00516031   1/2  ----------------------------------------------------------------------
00403192   2/2  ----------------------------------------------------------------------
00453181   1/1  -------------------------------------------------------------------Ivg
00388281   1/2  ----------------------------------------------------------------------
00443101   1/2  ----------------------------------------------------------------------
00508332   2/2  ----------------------------------------------------------------------
00527271   1/2  ----------------------------------------------------------------------
00412431   1/2  ----------------------------------------------------------------------
00412461   1/2  ----------------------------------------------------------------------
00500572   2/2  ----------------------------------------------------------------------
00428441   1/2  ----------------------------------------------------------------------
00505161   1/2  ----------------------------------------------------------------------
00443371   1/2  ----------------------------------------------------------------------
00505532   2/2  ----------------------------------------------------------------------
00505502   2/2  ----------------------------------------------------------------------
00504921   1/2  ----------------------------------------------------------------------
00520771   1/2  ----------------------------------------------------------------------
00408581   1/1  -----------------------------------------------------------------IvgGt
00443112   2/2  ----------------------------------------------------------------------
00374852   2/2  ----------------------------------------------------------------------
00498762   2/2  ----------------------------------------------------------------------
00499462   2/2  ----------------------------------------------------------------------
00443662   2/2  ----------------------------------------------------------------------
00380152   2/2  ----------------------------------------------------------------------
00421161   1/2  ----------------------------------------------------------------------
00508571   1/2  ----------------------------------------------------------------------
00505722   2/2  ----------------------------------------------------------------------
00505411   1/2  ----------------------------------------------------------------------
00498782   2/2  ----------------------------------------------------------------------
00446232   2/2  ----------------------------------------------------------------------
00459042   2/2  ----------------------------------------------------------------------
00508362   2/2  ----------------------------------------------------------------------
00434102   2/2  ----------------------------------------------------------------------
00422692   2/2  ----------------------------------------------------------------------
00505842   2/2  ----------------------------------------------------------------------
00446882   2/2  ----------------------------------------------------------------------
00526502   2/2  ----------------------------------------------------------------------
00380591   1/1  ----------------------------------------------------------------------
00459402   2/2  ----------------------------------------------------------------------
00446381   1/2  ----------------------------------------------------------------------
00443152   2/2  ----------------------------------------------------------------------
00522812   2/2  ----------------------------------------------------------------------
00402941   1/2  ----------------------------------------------------------------------
00413572   2/2  ----------------------------------------------------------------------
00417752   2/2  ----------------------------------------------------------------------
00495212   2/2  ----------------------------------------------------------------------
00497812   2/2  ----------------------------------------------------------------------
00426012   2/2  ----------------------------------------------------------------------
00505741   1/2  ----------------------------------------------------------------------
00501162   2/2  ----------------------------------------------------------------------
00489002   2/2  ----------------------------------------------------------------------
00388282   2/2  ----------------------------------------------------------------------
00443912   2/2  ----------------------------------------------------------------------
00500632   2/2  ----------------------------------------------------------------------
00403992   2/2  ----------------------------------------------------------------------
00508572   2/2  ----------------------------------------------------------------------
00481382   2/2  ----------------------------------------------------------------------
00477312   2/2  ----------------------------------------------------------------------
00381592   2/2  ----------------------------------------------------------------------
00408062   2/2  ----------------------------------------------------------------------
00443102   2/2  ----------------------------------------------------------------------
00522702   2/2  ----------------------------------------------------------------------
00505162   2/2  ----------------------------------------------------------------------
00505412   2/2  ----------------------------------------------------------------------
00390282   2/2  ----------------------------------------------------------------------
00516432   2/2  ----------------------------------------------------------------------
00400422   2/2  ----------------------------------------------------------------------
00505072   2/2  ----------------------------------------------------------------------
00504872   2/2  ----------------------------------------------------------------------
00508352   2/2  ----------------------------------------------------------------------
00501142   2/2  ----------------------------------------------------------------------
00443372   2/2  ----------------------------------------------------------------------
00497802   2/2  ----------------------------------------------------------------------
00412462   2/2  ----------------------------------------------------------------------
00499481   1/2  ----------------------------------------------------------------------
00443982   2/2  ----------------------------------------------------------------------
00443992   2/2  ----------------------------------------------------------------------
00504862   2/2  ----------------------------------------------------------------------
00446382   2/2  ----------------------------------------------------------------------
00506182   2/2  ----------------------------------------------------------------------
00412432   2/2  ----------------------------------------------------------------------
00415552   2/2  ----------------------------------------------------------------------
00426872   2/2  ----------------------------------------------------------------------
00526632   2/2  ----------------------------------------------------------------------
00421162   2/2  ----------------------------------------------------------------------
00499482   2/2  ----------------------------------------------------------------------
00516032   2/2  ----------------------------------------------------------------------
00504922   2/2  ----------------------------------------------------------------------
00505742   2/2  ----------------------------------------------------------------------
00527272   2/2  ----------------------------------------------------------------------
00520772   2/2  ----------------------------------------------------------------------
00378401   1/1  -------------------------------------------------------------------Ivg
00428442   2/2  ----------------------------------------------------------------------
00402942   2/2  ----------------------------------------------------------------------
00377861   1/1  -------------------------------------------------------------------Ivg
00371311   1/1  ----------------------------------------------------------------------
00424161   1/1  ----------------------------------------------------------------------
00443821   1/2  ----------------------------------------------------------------------
00443822   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTDFPFAKLSEGK
00490341   1/1  glGsGflis.dglvlTnaHVvedadelpssivfvlglnnllaiyvtlsdgrvytakvvgvfgldpdlDlA
00403511   1/1  glgsGfiispdgyilTnaHvvegadeitvtlgdgreyeakvvgldpeyDlAllkldsplanlpplklgds
00436831   1/1  glgsGfiisedGyilTnahvvegaddvtvvladgrrvpakvvgldpelDlAllkidsdlplpplplgdsd
00488771   1/1  ealpgvapsvvslqvvsdggr..glgsGfli..dgyvlTaaHvvedgadeitvrlsdgrfeveakvvlkv
00415371   1/1  glGsGfiiskdGyilTnaHVveg...........................avLkid.ggplppll.....
00479071   1/1  qllgrsvvlilvdgggglglgsGflispdlgyvLTaaHvvegadeitvrlgdgqvyeakvvgvdpdyDiA
00481331   1/1  lapsvvlivgsslGsGfiispdgglyilTnaHVvegadeitvrl.dgreypak...idpelDlAellkld
00350421   1/1  glgsGflis.dglvLTaaHvvegadevpvtlsvvlglldldlllllsdgrtyeakvvgvhpgdpglDlAl
00490101   1/1  slgsggilisdgyvlTaaHcvagasevtv...dgrvlgaevvgvdpdnDiAllkldspvtlsslvapill
00430391   1/1  glgtGflis.kglvlTaaHvvygadgvtvtvvlgapglngllapdgrvvvakvvgldpnlDlAllkldsp
00512431   1/1  llglfpsvvslqvldlggrglgsGflispdgyvLTaaHvvegaltvrlgaldlditvtlsdgqvveakvi
00361541   1/1  ----------------NahVvagad...vvladgrtleAkvvgtdplldlavlkidgkdknelllpvlvl
00532991   1/1  gcggglivdddggtlyvlTaaHcvegasevtvvlgdgrvvgakvvgtdpdnDlavlkldspvvlpslvlp
00355001   1/1  glgsGfii..dglilTnaHvvggadlvtv......tfpatvvgadpklDlallklp.......lgls.sd
00479571   1/1  rglcgGflispdgyvLTaaHcvegassitvrlgdgqvvevkvvivhpdyDiAllkldspvnvppiclpds
00527371   1/1  glgsGflvspnglvlTnaHvveg...itvllgdgr...atlvgadpglDlallklp.......lgls.sl
00533001   1/1  .lgcggilisdgyvlTaaHcvaga........dgvvlgatvvgvdpgyDlallkldspvtlsdlvlpigl
00472181   1/1  glcsgsiivlddsdgyvlTAaHcvagassvtvrl.dgtvvgatvvgvhpgyDiAllkldssvtlsdvvlp
00501391   1/1  glgtGfvvdkdglvlTnaHV.....................vgvdpaldlAllkvdgl.slp.......d
00436031   1/1  ..cgGslivldssdgyvlTAaHcvagassvtvvlgdgqvvkvtvvivhpgyDiAllkldspvvlsslnvq
00421341   1/1  sllllggs..hlCgGslispn.lvLTAaHCvyglasllsaskitvrlgsldlssdgqvvkvkkiivhpny
00404551   1/2  ----------------------------------------------------------------------
00434101   1/2  ----------------------------------------------------------------------
00443111   1/2  ----------------------------------------------------------------------
00500571   1/2  ----------------------------------------------------------------------
00436821   1/2  ----------------------------------------------------------------------
00351821   1/1  glCtGslinnngndkllyvlTAaHCvagtasvassvtvrlgatdlnsdngtellsygggvlsvskiivhp
00403171   1/2  ----------------------------------------------------------------------
00413571   1/2  ----------------------------------------------------------------------
00385121   1/1  glcgGlli.sgnwvltpaHcveg.lkvvlglvnifvtdakvvvievilvelvnlsgpenDlallklp.kp
00512421   1/2  ----------------------------------------------------------------------
00403191   1/2  ----------------------------------------------------------------------
00459401   1/2  ----------------------------------------------------------------------
00505531   1/2  ----------------------------------------------------------------------
00505721   1/2  ----------------------------------------------------------------------
00526501   1/2  ----------------------------------------------------------------------
00505501   1/2  ----------------------------------------------------------------------
00459041   1/2  ----------------------------------------------------------------------
00498761   1/2  ----------------------------------------------------------------------
00443151   1/2  ----------------------------------------------------------------------
00443661   1/2  ----------------------------------------------------------------------
00403531   1/1  gegsglli.gdnyvltnaHvv.pdelilvplrdvfvldaevlvngsgpnlDlavlkldrngkfrdirkli
00426011   1/2  ----------------------------------------------------------------------
00508351   1/2  ----------------------------------------------------------------------
00489001   1/2  ----------------------------------------------------------------------
00390281   1/2  ----------------------------------------------------------------------
00516431   1/2  ----------------------------------------------------------------------
00504861   1/2  ----------------------------------------------------------------------
00361161   1/1  favslpknvsvqittgkgfgsgllisgn.yvltaaHlvng.ddisvpgvdvkvldavkhpiynglnnDla
00499461   1/2  ----------------------------------------------------------------------
00374851   1/2  ----------------------------------------------------------------------
00446881   1/2  ----------------------------------------------------------------------
00443911   1/2  ----------------------------------------------------------------------
00505841   1/2  ----------------------------------------------------------------------
00505071   1/2  ----------------------------------------------------------------------
00422691   1/2  ----------------------------------------------------------------------
00408061   1/2  ----------------------------------------------------------------------
00381591   1/2  ----------------------------------------------------------------------
00498781   1/2  ----------------------------------------------------------------------
00508331   1/2  ----------------------------------------------------------------------
00380151   1/2  ----------------------------------------------------------------------
00477311   1/2  ----------------------------------------------------------------------
00506181   1/2  ----------------------------------------------------------------------
00415551   1/2  ----------------------------------------------------------------------
00497811   1/2  ----------------------------------------------------------------------
00443981   1/2  ----------------------------------------------------------------------
00352831   1/1  --CgGslispr.wvLTAahcvlgaslltvrlgshdlsvlesggqvvrvkkiivhpdyngstldnDiALlk
00446231   1/2  ----------------------------------------------------------------------
00522811   1/2  ----------------------------------------------------------------------
00504871   1/2  ----------------------------------------------------------------------
00508361   1/2  ----------------------------------------------------------------------
00417751   1/2  ----------------------------------------------------------------------
00403991   1/2  ----------------------------------------------------------------------
00400421   1/2  ----------------------------------------------------------------------
00495211   1/2  ----------------------------------------------------------------------
00497801   1/2  ----------------------------------------------------------------------
00512422   2/2  ----------------------------------------------------------------------
00522701   1/2  ----------------------------------------------------------------------
00501141   1/2  ----------------------------------------------------------------------
00404552   2/2  ----------------------------------------------------------------------
00500631   1/2  ----------------------------------------------------------------------
00501161   1/2  ----------------------------------------------------------------------
00526631   1/2  ----------------------------------------------------------------------
00443991   1/2  ----------------------------------------------------------------------
00426871   1/2  ----------------------------------------------------------------------
00403172   2/2  ----------------------------------------------------------------------
00481381   1/2  ----------------------------------------------------------------------
00436822   2/2  ----------------------------------------------------------------------
00516031   1/2  ----------------------------------------------------------------------
00403192   2/2  ----------------------------------------------------------------------
00453181   1/1  GteaepgefPwqvsllllllsggshlCgGslispr.wVLTaahCvlgaslltvrlgshdlssgeqvvrve
00388281   1/2  ----------------------------------------------------------------------
00443101   1/2  ----------------------------------------------------------------------
00508332   2/2  ----------------------------------------------------------------------
00527271   1/2  ----------------------------------------------------------------------
00412431   1/2  ----------------------------------------------------------------------
00412461   1/2  ----------------------------------------------------------------------
00500572   2/2  ----------------------------------------------------------------------
00428441   1/2  ----------------------------------------------------------------------
00505161   1/2  ----------------------------------------------------------------------
00443371   1/2  ----------------------------------------------------------------------
00505532   2/2  ----------------------------------------------------------------------
00505502   2/2  ----------------------------------------------------------------------
00504921   1/2  ----------------------------------------------------------------------
00520771   1/2  ----------------------------------------------------------------------
00408581   1/1  eakigefPwqvslllllssgs..hlCgGslispr.wvLTAahCvlgldaslltvrlgshdlsvleggqvv
00443112   2/2  ----------------------------------------------------------------------
00374852   2/2  ----------------------------------------------------------------------
00498762   2/2  ----------------------------------------------------------------------
00499462   2/2  ----------------------------------------------------------------------
00443662   2/2  ----------------------------------------------------------------------
00380152   2/2  ----------------------------------------------------------------------
00421161   1/2  ----------------------------------------------------------------------
00508571   1/2  ----------------------------------------------------------------------
00505722   2/2  ----------------------------------------------------------------------
00505411   1/2  ----------------------------------------------------------------------
00498782   2/2  ----------------------------------------------------------------------
00446232   2/2  ----------------------------------------------------------------------
00459042   2/2  ----------------------------------------------------------------------
00508362   2/2  ----------------------------------------------------------------------
00434102   2/2  ----------------------------------------------------------------------
00422692   2/2  ----------------------------------------------------------------------
00505842   2/2  ----------------------------------------------------------------------
00446882   2/2  ----------------------------------------------------------------------
00526502   2/2  ----------------------------------------------------------------------
00380591   1/1  --IvgGteakigefPwqvslllggshlCgGslispr.wvLTAahCvlgldaslltvrlgshdlssggqvv
00459402   2/2  ----------------------------------------------------------------------
00446381   1/2  ----------------------------------------------------------------------
00443152   2/2  ----------------------------------------------------------------------
00522812   2/2  ----------------------------------------------------------------------
00402941   1/2  ----------------------------------------------------------------------
00413572   2/2  ----------------------------------------------------------------------
00417752   2/2  ----------------------------------------------------------------------
00495212   2/2  ----------------------------------------------------------------------
00497812   2/2  ----------------------------------------------------------------------
00426012   2/2  ----------------------------------------------------------------------
00505741   1/2  ----------------------------------------------------------------------
00501162   2/2  ----------------------------------------------------------------------
00489002   2/2  ----------------------------------------------------------------------
00388282   2/2  ----------------------------------------------------------------------
00443912   2/2  ----------------------------------------------------------------------
00500632   2/2  ----------------------------------------------------------------------
00403992   2/2  ----------------------------------------------------------------------
00508572   2/2  ----------------------------------------------------------------------
00481382   2/2  ----------------------------------------------------------------------
00477312   2/2  ----------------------------------------------------------------------
00381592   2/2  ----------------------------------------------------------------------
00408062   2/2  ----------------------------------------------------------------------
00443102   2/2  ----------------------------------------------------------------------
00522702   2/2  ----------------------------------------------------------------------
00505162   2/2  ----------------------------------------------------------------------
00505412   2/2  ----------------------------------------------------------------------
00390282   2/2  ----------------------------------------------------------------------
00516432   2/2  ----------------------------------------------------------------------
00400422   2/2  ----------------------------------------------------------------------
00505072   2/2  ----------------------------------------------------------------------
00504872   2/2  ----------------------------------------------------------------------
00508352   2/2  ----------------------------------------------------------------------
00501142   2/2  ----------------------------------------------------------------------
00443372   2/2  ----------------------------------------------------------------------
00497802   2/2  ----------------------------------------------------------------------
00412462   2/2  ----------------------------------------------------------------------
00499481   1/2  ----------------------------------------------------------------------
00443982   2/2  ----------------------------------------------------------------------
00443992   2/2  ----------------------------------------------------------------------
00504862   2/2  ----------------------------------------------------------------------
00446382   2/2  ----------------------------------------------------------------------
00506182   2/2  ----------------------------------------------------------------------
00412432   2/2  ----------------------------------------------------------------------
00415552   2/2  ----------------------------------------------------------------------
00426872   2/2  ----------------------------------------------------------------------
00526632   2/2  ----------------------------------------------------------------------
00421162   2/2  ----------------------------------------------------------------------
00499482   2/2  ----------------------------------------------------------------------
00516032   2/2  ----------------------------------------------------------------------
00504922   2/2  ----------------------------------------------------------------------
00505742   2/2  ----------------------------------------------------------------------
00527272   2/2  ----------------------------------------------------------------------
00520772   2/2  ----------------------------------------------------------------------
00378401   1/1  GteakigefPwqvsllllggshlCgGslispr.wvLTaahcvlgaslltvrlgsldlssleeggqvvrvk
00428442   2/2  ----------------------------------------------------------------------
00402942   2/2  ----------------------------------------------------------------------
00377861   1/1  GteakigefPwqvslllllsggshlCgGsLispr.wvLTAahCvlgldaslltvrlgshdlsvleggqvv
00371311   1/1  --CgGslispr.wvLTaahCvlglsdaslltvrlgahdlssggqvvrvkkiivhpdynsltldnDiALlk
00424161   1/1  -lCgGsLispr.wvLTAahCvlgldaslltvrlgshdlsvleggqvvrvekiivhpdynsstldnDiALl
00443821   1/2  ----------------------------------------------------------------------
00443822   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAI
00490341   1/1  llkldaplggvllgdnlpplplgdsdklkvgdlvlaiGyPlglpltvtlgivsalgr.........flqt
00403511   1/1  ddlkvgdkvlaiGyplglgltvtsgivsalgrtvcppggrlinlgliqtdaainpGnSGGPllnldgevv
00436831   1/1  alkvgdlvlaiGyplglgltvtsgivsalgrsvlgrgtvlgliqtdaainpGnSGGPlvnsdGevvGins
00488771   1/1  gvdpgyDlAllkldkp.vlpvlllgdsdalkvgelvlaiGwpfg..qtvtvgivsalgrlv.ggltagfi
00415371   1/1  lrvgedviaiGnPlgldllltvtagivsallrtldadllalqlllggvlldliqtdaainpGnSGGPlln
00479071   1/1  llkldsplnlppiplpdsddlkvgelvlviGwplglgltvtsgilsavnrpvvslgetddmictdadicp
00481331   1/1  gdvelglpplklgdsdplrvglvlaiGnpfglg.....................gfiqtdaainpGnSGg
00350421   1/1  lklespvdglllgdnlpplklgdsddlkvgdlvlaiGyplgllrtvtlgivsaltrl......ddliqtd
00490101   1/1  pltlgdsddlavgdlvlaiGwptg....vtvgivsalgrtvlyggglcagliqtdaainpGdSGGPlvnl
00430391   1/1  ldgvlfglnvpplklgdsddlkvgdkvtviGyplgllqtvtvgivsaler.....itgnmiqtdadtcpG
00512431   1/1  ivdpdyDiAllkldspdnlppiklpdsddlkvgelvlaiGwplglegtvtsgilsavnvpilslsvitgg
00361541   1/1  gdsddlrvGvllnGvlytvyhgaggktlagpggpllplwanvdedvvaiGnPlgldllntvtagivslll
00532991   1/1  iglssllvvgeavlaignpvcvsGlgttvtcgivsalnrtvnyggglvlegliqtdaainpGDSGGPlvn
00355001   1/1  lkvgelvlvigyplglpltvtqgivsalsrlvg.....dliqtdadinpGnSGgPllnsngevvGinsag
00479571   1/1  dllkvgelvlviGwgsgllqtvtlgivsalecsllygggllitdnmicagadicpGdSGGPlvdldgelv
00527371   1/1  lkvgelvlvigyplglsltvtqgivsalkrllg.....gliqtdadinpGnSGgPvldsngevvGlv...
00533001   1/1  pvlglgdsddlavgtlvlaiGwptg....ltagivsalnrtvcitdgmlcagliqtdaaicpGdSGGPlv
00472181   1/1  iglpvaglgdsselavgtlvlasGwgtg....vtvgivsalnctvnygggitdgmiqtdaaicpGdSGGp
00501391   1/1  lkvgelvlaikGyplgldltvtlgivsalgglvlllggr.viqtdaainpGnSGGPlldskgrvvGivta
00436031   1/1  pislpdsdllavgtlvlaiGwglg....ltagivsalsrsvcitdgmlcagliqtgadicpGdSGGPlvn
00421341   1/1  nlgtdldnDiAllkldsplsdnvqpiclpssdllvgtlvtviGwgltleggvtsgilqavnvpvvsleec
00404551   1/2  ----------------------------------------------------------------------
00434101   1/2  --------------------------------------------------------------ligintai
00443111   1/2  ----------------------------------------------------------------------
00500571   1/2  ----------------------------------------------------------------------
00436821   1/2  ----------------------------------------------------------------------
00351821   1/1  gynstdlnnDiAllklespvtaglvvtvagwgrtaavgesvlviglplgdlttvtlgtcsalyatvggsl
00403171   1/2  ----------------------------------------------------------------------
00413571   1/2  --------------------------------------------------------------------li
00385121   1/1  vpfrdivkliplaidlgrlgdlpgglgvlvvsnplggplqfvgvgvvstkgilsydgr.tgdntcrgfle
00512421   1/2  ----------------------------------------------------------------------
00403191   1/2  ----------------------------------------------------------------------
00459401   1/2  -------------------------------------------------------pvnlygevigintvi
00505531   1/2  ----------------------------------------------------------------------
00505721   1/2  ----------------------------------------------------------------------
00526501   1/2  ----------------------------------------------------------------------
00505501   1/2  ----------------------------------------------------------ldgevigirtvi
00459041   1/2  ---------------------------------------------------------nlllelldprtvi
00498761   1/2  ----------------------------------------------------------------------
00443151   1/2  ----------------------------------------------------------------------
00443661   1/2  ----------------------------------------------------------------------
00403531   1/1  psclppagvyvlvinnsgvpitvtgvgivfilgslvtsg...........rtqanllqydaptepGdcGG
00426011   1/2  ------------------------------------------------------------gevvgirtvi
00508351   1/2  ----------------------------------------------------------------------
00489001   1/2  ----------------------------------------------------------------------
00390281   1/2  ----------------------------------------------------------------------
00516431   1/2  ---------------------------------------------------------------------i
00504861   1/2  ---------------------------------------------------------------lginlri
00361161   1/1  llkldtiakfrdivklipsdlvdggecvvagwgktgpptvvsvgivsayglliydgticaglleydaptc
00499461   1/2  ---------------------------------------------------------yldgevigirtvi
00374851   1/2  ----------------------------------------------------------------------
00446881   1/2  --------------------------------------------------------------llgivllv
00443911   1/2  ----------------------------------------------------------------------
00505841   1/2  -----------------------------------------lldaiigslnslgdplslllspilelevl
00505071   1/2  --------------------------------------------------------yslyldllgielli
00422691   1/2  ----------------------------------------------------------------------
00408061   1/2  -----------------------------------------------------------sgeviginlvi
00381591   1/2  ----------------------------------------------------------------------
00498781   1/2  ---------------------------------------------------------slllsklelvrli
00508331   1/2  ----------------------------------------------------------------------
00380151   1/2  ----------------------------------------------------------------------
00477311   1/2  ----------------------------------------------------------------------
00506181   1/2  ------------------------------------------------------------glllgllllv
00415551   1/2  ----------------------------------------------------------------------
00497811   1/2  ----------------------------------------------------------------lilllv
00443981   1/2  ----------------------------------------------------------------------
00352831   1/1  lsepvtlsdyvqpiclpssdllvgtlclvsGwgltsegglplsdvlqevtvpivsneecrlayg....li
00446231   1/2  ----------------------------------------------------------------------
00522811   1/2  ----------------------------------------------------------------------
00504871   1/2  ----------------------------------------------------------------------
00508361   1/2  ----------------------------------------------------------------------
00417751   1/2  ----------------------------------------------------------------------
00403991   1/2  ----------------------------------------------------------------------
00400421   1/2  ----------------------------------------------------------------evrtvt
00495211   1/2  ----------------------------------------------------------------------
00497801   1/2  ----------------------------------------------------------------------
00512422   2/2  ----------------------------------------------------------------------
00522701   1/2  ----------------------------------------------------------------------
00501141   1/2  ----------------------------------------------------------------------
00404552   2/2  ----------------------------------------------------------------------
00500631   1/2  --------------------------------------------------lssldplsllllpgevrlvt
00501161   1/2  ----------------------------------------------------------------------
00526631   1/2  ----------------------------------------------------------------------
00443991   1/2  ----------------------------------------------------------------------
00426871   1/2  ----------------------------------------------------------------------
00403172   2/2  ----------------------------------------------------------------------
00481381   1/2  ----------------------------------------------------------------------
00436822   2/2  ----------------------------------------------------------------------
00516031   1/2  ----------------------------------------------------------------elrtvt
00403192   2/2  ----------------------------------------------------------------------
00453181   1/1  kiivhpdynsstldnDiALlkLe.pvtlsdyvqpiclpssdllllllvgtlctvsGwgltsdgsdvlqev
00388281   1/2  --------------------------------------------------------------lngllsll
00443101   1/2  ----------------------------------------------------------------------
00508332   2/2  ----------------------------------------------------------------------
00527271   1/2  ----------------------------------------------------------------------
00412431   1/2  ----------------------------------------------------------------------
00412461   1/2  ----------------------------------------------------------------------
00500572   2/2  ----------------------------------------------------------------------
00428441   1/2  --------------------------------------------------------------llelllvt
00505161   1/2  --------------------------------------------------------------llpaaisl
00443371   1/2  ----------------------------------------------------------------------
00505532   2/2  ----------------------------------------------------------------------
00505502   2/2  ----------------------------------------------------------------------
00504921   1/2  ----------------------------------------------------------------------
00520771   1/2  ----------------------------------------------------------------elrlvt
00408581   1/1  rvekiivhpdynslgltldnDiALlkLsepvtlsdyvqpiclpsssllllvgtlclvsGwgltleggvls
00443112   2/2  ----------------------------------------------------------------------
00374852   2/2  ----------------------------------------------------------------------
00498762   2/2  ----------------------------------------------------------------------
00499462   2/2  ----------------------------------------------------------------------
00443662   2/2  ----------------------------------------------------------------------
00380152   2/2  ----------------------------------------------------------------------
00421161   1/2  -------------------------------------------------------llsslllllevrlvt
00508571   1/2  ----------------------------------------------------------------------
00505722   2/2  ----------------------------------------------------------------------
00505411   1/2  ----------------------------------------------------------------------
00498782   2/2  ----------------------------------------------------------------------
00446232   2/2  ----------------------------------------------------------------------
00459042   2/2  ----------------------------------------------------------------------
00508362   2/2  ----------------------------------------------------------------------
00434102   2/2  ----------------------------------------------------------------------
00422692   2/2  ----------------------------------------------------------------------
00505842   2/2  ----------------------------------------------------------------------
00446882   2/2  ----------------------------------------------------------------------
00526502   2/2  ----------------------------------------------------------------------
00380591   1/1  rveriivhpgynsldnDiALlkleepvtlsdyvqpiclpssdllllvgtlvlvsGwgltsegglllsdvl
00459402   2/2  ----------------------------------------------------------------------
00446381   1/2  ----------------------------------------------------------------------
00443152   2/2  ----------------------------------------------------------------------
00522812   2/2  ----------------------------------------------------------------------
00402941   1/2  ----------------------------------------------------------------------
00413572   2/2  ----------------------------------------------------------------------
00417752   2/2  ----------------------------------------------------------------------
00495212   2/2  ----------------------------------------------------------------------
00497812   2/2  ----------------------------------------------------------------------
00426012   2/2  ----------------------------------------------------------------------
00505741   1/2  ----------------------------------------------------------------------
00501162   2/2  ----------------------------------------------------------------------
00489002   2/2  ----------------------------------------------------------------------
00388282   2/2  ----------------------------------------------------------------------
00443912   2/2  ----------------------------------------------------------------------
00500632   2/2  ----------------------------------------------------------------------
00403992   2/2  ----------------------------------------------------------------------
00508572   2/2  ----------------------------------------------------------------------
00481382   2/2  ----------------------------------------------------------------------
00477312   2/2  ----------------------------------------------------------------------
00381592   2/2  ----------------------------------------------------------------------
00408062   2/2  ----------------------------------------------------------------------
00443102   2/2  ----------------------------------------------------------------------
00522702   2/2  ----------------------------------------------------------------------
00505162   2/2  ----------------------------------------------------------------------
00505412   2/2  ----------------------------------------------------------------------
00390282   2/2  ----------------------------------------------------------------------
00516432   2/2  ----------------------------------------------------------------------
00400422   2/2  ----------------------------------------------------------------------
00505072   2/2  ----------------------------------------------------------------------
00504872   2/2  ----------------------------------------------------------------------
00508352   2/2  ----------------------------------------------------------------------
00501142   2/2  ----------------------------------------------------------------------
00443372   2/2  ----------------------------------------------------------------------
00497802   2/2  ----------------------------------------------------------------------
00412462   2/2  ----------------------------------------------------------------------
00499481   1/2  ----------------------------------------------------------------------
00443982   2/2  ----------------------------------------------------------------------
00443992   2/2  ----------------------------------------------------------------------
00504862   2/2  ----------------------------------------------------------------------
00446382   2/2  ----------------------------------------------------------------------
00506182   2/2  ----------------------------------------------------------------------
00412432   2/2  ----------------------------------------------------------------------
00415552   2/2  ----------------------------------------------------------------------
00426872   2/2  ----------------------------------------------------------------------
00526632   2/2  ----------------------------------------------------------------------
00421162   2/2  ----------------------------------------------------------------------
00499482   2/2  ----------------------------------------------------------------------
00516032   2/2  ----------------------------------------------------------------------
00504922   2/2  ----------------------------------------------------------------------
00505742   2/2  ----------------------------------------------------------------------
00527272   2/2  ----------------------------------------------------------------------
00520772   2/2  ----------------------------------------------------------------------
00378401   1/1  kiivhpdynsstldnDiALlkLeepvtlsdyvqpiclpssdllvgtlctvsGwgltsegglllsdvlqev
00428442   2/2  ----------------------------------------------------------------------
00402942   2/2  ----------------------------------------------------------------------
00377861   1/1  rvekiivhpdynsstldnDiALlkLsepvtlsdyvqpiclplase...lllvgtlctvsGwgltseggll
00371311   1/1  leepvtlsdyvqpiclpssdlllvgtlctvsGwgltseggllsdvlqevnvpvvsnevcralyglitdnm
00424161   1/1  kLsepvtlsdyvqpiclpssdllllvgtlctvsGwgltseggllsdvlqevnvpvvsnevcdnmlcaggl
00443821   1/2  ----------------------------------------------------------------------
00443822   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGP
00490341   1/1  dadinpGnSGGPlfnldgelvGinsagl....gslgigfaipint-------------------------
00403511   1/1  Ginsaglgesgg.ggigfaipvnlvldv------------------------------------------
00436831   1/1  aglgesggsdllvgigfaipidlvldvleqli--------------------------------------
00488771   1/1  qtdadtnpGdSGGPlvnlndgevvGihsag..sgggspgigfaipsdflk.vleqli-------------
00415371   1/1  ldGevvGintailsssggaagigf.iPintakevldql--------------------------------
00479071   1/1  GdSGGPlvnldgevvGivsaglgcgggglgp---------------------------------------
00481331   1/1  Plvn.dgevvGinsa.....ggsegigfaipinlvlrvldqli.kgevlrgvlgvllqldvlltgelae-
00350421   1/1  adinpGnSGGPlfnsngelvGivsagls------------------------------------------
00490101   1/1  dgelvGivsagsgcggggllpgvytrgigf----------------------------------------
00430391   1/1  dSGgPlfnsdgevvGivsggv.geg....igfa-------------------------------------
00512431   1/1  mlcagliqtdadicpGdSGGPlvnldgelvGi--------------------------------------
00361541   1/1  vtgdalvrsvrllggslledliqtdaainpGnSGG-----------------------------------
00532991   1/1  .ggtlvGivsagsg.gggsggpgfaipv------------------------------------------
00355001   1/1  vve.....gigfaipvdtvldvieqlikkgkve-------------------------------------
00479571   1/1  Givsaglgc.....gpgvytpvsl----------------------------------------------
00527371   1/1  ........gigfaipidtvlsvidqlie------------------------------------------
00533001   1/1  n.ggvlvGivsags.gcggsggpgfaip------------------------------------------
00472181   1/1  lvn.ggqlvGivsggs.gcggsggpgfy------------------------------------------
00501391   1/1  ga..gdgsqglgfavpidlvlrllkqliegge--------------------------------------
00436031   1/1  .ngqlvGivsag.sgcggsggpgvytpv------------------------------------------
00421341   1/1  .micagadtcpGdSGgPlvngngvlvGi------------------------------------------
00404551   1/2  ---------------------------------rpllGvllldltpelaeelgllllllldvllgvlvls
00434101   1/2  lsisgglagllfaipsllallvlevllvtlekspgglGfslvggtdelaeslglegdlgifvssvlpggp
00443111   1/2  --plggllglgfaipsnlalevltvllvkgp...gglGfslvg.........gldgdlgvvvssvlpggp
00500571   1/2  -----gslgipfaipldlaelrlvtlvkgg...rgglGfslvggtd.....lglegdggvvvssvlpgsp
00436821   1/2  --------------------------------agpglGfslagltdelafllgldgdkgvvvtsvlpgsp
00351821   1/1  itdgmlcaglqtgadtcpGdSGGPllnsngqvvGivsggsgcgsasdlg---------------------
00403171   1/2  -------------------------------vagpllGislagltdllafllgldvdkgvvvssvlpgsp
00413571   1/2  lsilggllglgfaipsllallvlevllvtlkkdsgglGfslvggtdelalalglegdlgifvssvlpggp
00385121   1/1  ydadtcpGdcGGpLvcnnggldgkivGihs----------------------------------------
00512421   1/2  --------------------------------ergllGlglvlltde..........ggvvvvsvlpgsp
00403191   1/2  ---------------------------------rgllgvllqdltlllalllgldldkgvlvtsvlpgsp
00459401   1/2  lsksggglGfgi.......................................vggkddggvlvssvlpgsp
00505531   1/2  -----gldgisfaipidlaelvlvtllkgg....gglGfslvg.............gggvlvssvlpgsp
00505721   1/2  -----gllgigfaipinlaklvlvtlikgg...rgglGfslvggtde.........dggvlvssvlpgsp
00526501   1/2  ----------------------leqlvvllkvergglGislvggtdelaealglegdggvlvasvlpgsp
00505501   1/2  lsksggglGfai................................vggldlllgleldggvvvssvlpgsp
00459041   1/2  lskgelgglGfsi.......................................vggkddggvvvssvlpgg
00498761   1/2  ---------isfaipkslaerllvvlakggg....glGfsivggtdl..lllglllllgvvvssvlpgsp
00443151   1/2  ------slgigfaipislalpvlellvrlvelvkgpggglGfslvg.........gldsglgifvssvlp
00443661   1/2  ------------aipinlaelvlvtlikgg....gglGfslvggtdllaeslglgd.lgvvvssvlpgsp
00403531   1/1  plvc.ngkviGihva-------------------------------------------------------
00426011   1/2  llk.gglgglgfaivgglalpvl........................lalllllegdggvvvssvlpgsp
00508351   1/2  ------------aipinlaklvlvqlikgg....gglGislvgltdel...lllegdggvlvssvlpgsp
00489001   1/2  -----------faipinlaelllvtlvkgg....gglGlslvggtdelaeslgled.ggvvvssvlpgsp
00390281   1/2  --------------------pvlellvvllkkergglGfslvggtpel...lllegdlgvvvssvlpgsp
00516431   1/2  lslsggllglgfaipsllaervvvllkkgg....gglGfsivggtds......llgdlgifvssvlpgsp
00504861   1/2  vtlskgsgglGfsi....................................aggldldggvvvssvlpgsp
00361161   1/1  pGdcGGpLvc.egkvvGihs--------------------------------------------------
00499461   1/2  lsksggglGfsi......................................vggldlllgdggvvvssvlp
00374851   1/2  ---kgglgglgfaiv....................................ggldvdlgvvvasvlpgsp
00446881   1/2  vllkgglgglgfai....................................vggldldlgvvvssvlpgsp
00443911   1/2  -----gslglgfaipsnlallvlevllvtlvkgsgglGfslvggk....dslglegdlgifvssvlpggp
00505841   1/2  tvtlvkgpgglGfsi.......................................vggddgifvssvlpgg
00505071   1/2  vtlskgsgglGfsi....................................vggldgdggvvvssvlpgsp
00422691   1/2  --------------------lllelllvtlvkgggglGfslvggtd..........dggvlvssvlpgsp
00408061   1/2  vllskgseglGfsi.....................................lggkddlgvfvssvlpgsp
00381591   1/2  --------------------lvlelllvtlvkgrgglGfslvggtdl......legdggvlvssvlpgsp
00498781   1/2  vllkgglgglgfai....................................vggldldggvvvssvlpgsp
00508331   1/2  -------------lllllllevrlvtlvkgg..ggglGfsivg.........gldldlgvvvssvlpgsp
00380151   1/2  -------------------llllllvllvkg..rgglGfslvggtd..........dlgvvvssvlpgsp
00477311   1/2  ----------------------------------GlLgadleld....gggvvvasvlpgdvsnpnlksP
00506181   1/2  vllkggggglGfsi....................................vggldldlgvvvssvlpgsp
00415551   1/2  ----------------------------------gllgvrlvtltkdlagglgfslv.gvvvtsvlpgsp
00497811   1/2  vllkggsgglGfsiv...........................................gvvvssvlpgsp
00443981   1/2  --------------plslallelellvvllkkgggglGfslvggkdslagalgldldlgifvssvlpggp
00352831   1/1  tdnmlcaggqggkdacqgdsGgPlvc.rgvl---------------------------------------
00446231   1/2  --------------------------------------------------------gaaellvvllkkgg
00522811   1/2  -----------lsllllelrlvtlvkgeg.....gglGfslvggtdsl...lgldgdlgvvvssvlpggp
00504871   1/2  ----------------------lelrlvtlvkdlgglGlsivggtdelalslg...dggvfvssvlpggp
00508361   1/2  ----------dlsllllelrlvtlvk.....geggglGlslvggtd.....lgleldlgvvvssvlpgsp
00417751   1/2  ----------------------gprlvlllkgergglGftlvggtd............gvvvssvlpgsp
00403991   1/2  ----------------------evrlvelgkgsrgglGfslvggtde.......egdggvlvssvlpgsp
00400421   1/2  llkgggglGfsl.................................vggadlllldgdlgvfvssvlpggp
00495211   1/2  ---------------------llelrlvtlvkgrgglGlslvggtdll......lgdggvvvssvlpgsp
00497801   1/2  ------------------------llvvllkksggglGlslvggtg.......leldggvvvssvlpgsp
00512422   2/2  ----------------------------------------------------------------------
00522701   1/2  ----------llsllllevrlvtlvkgs.....ggglGfslvg.........gldsdlgvfvssvlpgsp
00501141   1/2  llslldplslylsplelelrlvtlvkge.....lgglGfslvggkd............gvvvssvlpgsp
00404552   2/2  ----------------------------------------------------------------------
00500631   1/2  lvkgeggglGfsl......................................vggldsgdggvfvssvlpg
00501161   1/2  ---------------------------------------------------fslvggdgvfvssvlpgsp
00526631   1/2  -------------------elrlvtlvkgsg....glGfslvggadsl....lllldggvvvssvlpgsp
00443991   1/2  ----------sfalpsleaelllvtlvkggg....glGfslvg..............ggvlvssvlpgsp
00426871   1/2  --------------pllevrlvtlvkge.....ggglGfslvg.........gldgdlgvvvssvlpgsp
00403172   2/2  ----------------------------------------------------------------------
00481381   1/2  -------------------------lvvllkkgggglGlslvggldl.......egdggvfvssvlpgsp
00436822   2/2  ----------------------------------------------------------------------
00516031   1/2  lvkgggglGfsi.................................vggadsllllldlgvlvssvlpggp
00403192   2/2  ----------------------------------------------------------------------
00453181   1/1  tvpivsneecralyggllitdnmlcagg------------------------------------------
00388281   1/2  dplssllsslsllslslllgevrtvtlvkge..gg.lGfsivggkdsll......gdggifvssvlpggp
00443101   1/2  -----------sllsslelelrlvtlvkgsg...g.lGfslvggkd.........gdlgivvssvlpggp
00508332   2/2  ----------------------------------------------------------------------
00527271   1/2  ----------------------lelllvtlvkglgglGfslvggtdll......sldggvvvssvlpgsp
00412431   1/2  ----------------elelllvellkgsgg.....lGfslvg.........gldgdggvvvssvlpgsp
00412461   1/2  ---------lllsalleglllvvllkkgg.....gglGfslvggkdslglsl.llgdlgifvssvlpggp
00500572   2/2  ----------------------------------------------------------------------
00428441   1/2  llkgsgglGfsl.................................vggadslllegdlgvvvssvlpgsp
00505161   1/2  llslldpsslllsllelevrtvtlvkgpgg......lGfsivggkdspl.....egdlgifvssvlpggp
00443371   1/2  ------------ssllgevrlvtlvkgs......gglGfslvggkds........gdlgifvssvlpggp
00505532   2/2  ----------------------------------------------------------------------
00505502   2/2  ----------------------------------------------------------------------
00504921   1/2  ----------------------------------------------------------gifvssvlpggp
00520771   1/2  lvkgggglGfsl.................................vggadslllegdggifvssvlpggp
00408581   1/1  dvlqevnvpvvsnevcrslygllllll-------------------------------------------
00443112   2/2  ----------------------------------------------------------------------
00374852   2/2  ----------------------------------------------------------------------
00498762   2/2  ----------------------------------------------------------------------
00499462   2/2  ----------------------------------------------------------------------
00443662   2/2  ----------------------------------------------------------------------
00380152   2/2  ----------------------------------------------------------------------
00421161   1/2  lvk.geggglGfsi..................................vggldlegdlgivvssvlpgsp
00508571   1/2  -----------llldplelvllvvllkkgg....gglGfslvggldl........gdggifvssvlpggp
00505722   2/2  ----------------------------------------------------------------------
00505411   1/2  -----------------------------------------------gaaglellllllallsplegevv
00498782   2/2  ----------------------------------------------------------------------
00446232   2/2  ----------------------------------------------------------------------
00459042   2/2  ----------------------------------------------------------------------
00508362   2/2  ----------------------------------------------------------------------
00434102   2/2  ----------------------------------------------------------------------
00422692   2/2  ----------------------------------------------------------------------
00505842   2/2  ----------------------------------------------------------------------
00446882   2/2  ----------------------------------------------------------------------
00526502   2/2  ----------------------------------------------------------------------
00380591   1/1  qevtvpivsneecralyggllitdnml-------------------------------------------
00459402   2/2  ----------------------------------------------------------------------
00446381   1/2  --------------------------------gaelllslldllllpgevrlvtlvkdggglGfslvggv
00443152   2/2  ----------------------------------------------------------------------
00522812   2/2  ----------------------------------------------------------------------
00402941   1/2  -------------------------------------evrlvtlvkdsggglGfslvggkdggifvssvl
00413572   2/2  ----------------------------------------------------------------------
00417752   2/2  ----------------------------------------------------------------------
00495212   2/2  ----------------------------------------------------------------------
00497812   2/2  ----------------------------------------------------------------------
00426012   2/2  ----------------------------------------------------------------------
00505741   1/2  -----------------------------------------------lvggldlglllgifvssvlpggp
00501162   2/2  ----------------------------------------------------------------------
00489002   2/2  ----------------------------------------------------------------------
00388282   2/2  ----------------------------------------------------------------------
00443912   2/2  ----------------------------------------------------------------------
00500632   2/2  ----------------------------------------------------------------------
00403992   2/2  ----------------------------------------------------------------------
00508572   2/2  ----------------------------------------------------------------------
00481382   2/2  ----------------------------------------------------------------------
00477312   2/2  ----------------------------------------------------------------------
00381592   2/2  ----------------------------------------------------------------------
00408062   2/2  ----------------------------------------------------------------------
00443102   2/2  ----------------------------------------------------------------------
00522702   2/2  ----------------------------------------------------------------------
00505162   2/2  ----------------------------------------------------------------------
00505412   2/2  ----------------------------------------------------------------------
00390282   2/2  ----------------------------------------------------------------------
00516432   2/2  ----------------------------------------------------------------------
00400422   2/2  ----------------------------------------------------------------------
00505072   2/2  ----------------------------------------------------------------------
00504872   2/2  ----------------------------------------------------------------------
00508352   2/2  ----------------------------------------------------------------------
00501142   2/2  ----------------------------------------------------------------------
00443372   2/2  ----------------------------------------------------------------------
00497802   2/2  ----------------------------------------------------------------------
00412462   2/2  ----------------------------------------------------------------------
00499481   1/2  --------------------------------------------------------gaaaselllllleg
00443982   2/2  ----------------------------------------------------------------------
00443992   2/2  ----------------------------------------------------------------------
00504862   2/2  ----------------------------------------------------------------------
00446382   2/2  ----------------------------------------------------------------------
00506182   2/2  ----------------------------------------------------------------------
00412432   2/2  ----------------------------------------------------------------------
00415552   2/2  ----------------------------------------------------------------------
00426872   2/2  ----------------------------------------------------------------------
00526632   2/2  ----------------------------------------------------------------------
00421162   2/2  ----------------------------------------------------------------------
00499482   2/2  ----------------------------------------------------------------------
00516032   2/2  ----------------------------------------------------------------------
00504922   2/2  ----------------------------------------------------------------------
00505742   2/2  ----------------------------------------------------------------------
00527272   2/2  ----------------------------------------------------------------------
00520772   2/2  ----------------------------------------------------------------------
00378401   1/1  tlpvvsnevcralygllitdnmlcaggl------------------------------------------
00428442   2/2  ----------------------------------------------------------------------
00402942   2/2  ----------------------------------------------------------------------
00377861   1/1  sdvlqevtvpvvsnevcdnmlcaggleg------------------------------------------
00371311   1/1  lcaggeggkdacqgdsGgPlvc.ngvlvG-----------------------------------------
00424161   1/1  eggkdacqgdsGgPlvc.rgvlvGivsw------------------------------------------
00443821   1/2  ----------------------------------------------------------gifvskvlpgsp
00443822   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAKAGIESGDVITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVNDG
00490341   1/1  ----------------------------------------------------------------------
00403511   1/1  ----------------------------------------------------------------------
00436831   1/1  ----------------------------------------------------------------------
00488771   1/1  ----------------------------------------------------------------------
00415371   1/1  ----------------------------------------------------------------------
00479071   1/1  ----------------------------------------------------------------------
00481331   1/1  ----------------------------------------------------------------------
00350421   1/1  ----------------------------------------------------------------------
00490101   1/1  ----------------------------------------------------------------------
00430391   1/1  ----------------------------------------------------------------------
00512431   1/1  ----------------------------------------------------------------------
00361541   1/1  ----------------------------------------------------------------------
00532991   1/1  ----------------------------------------------------------------------
00355001   1/1  ----------------------------------------------------------------------
00479571   1/1  ----------------------------------------------------------------------
00527371   1/1  ----------------------------------------------------------------------
00533001   1/1  ----------------------------------------------------------------------
00472181   1/1  ----------------------------------------------------------------------
00501391   1/1  ----------------------------------------------------------------------
00436031   1/1  ----------------------------------------------------------------------
00421341   1/1  ----------------------------------------------------------------------
00404551   1/2  vlpgspAakaGLkpgDvIlavngkpvesledlvkll...kpgdtvtltvlRggelltltv----------
00434101   1/2  AaraGrLrvGDrIlevngvsvegltheeavellkga..ggtvtLlvlrg---------------------
00443111   1/2  AakaGrLkvGDvIlevngvsvegltheeavkllkgapvggtvtLtvlrggklltltvtlgelpl------
00500571   1/2  AaraGrLrvGDrIlavngvsvegltheeavellrga..ggtvtLtvlrdgklltvtltld----------
00436821   1/2  AakaGLkpgDvIlavngkpveglsdleavlllkkpgdtvtltvlrggklltltvtlgelpg---------
00351821   1/1  ----------------------------------------------------------------------
00403171   1/2  AakaGLkagDvIlavngvpvtgltdleavlllkkagdtvtLtvlrggklltltvt---------------
00413571   1/2  AaraGrLrvGDvIlevngvsveglsheeavallkga..ggtvtLlvl-----------------------
00385121   1/1  ----------------------------------------------------------------------
00512421   1/2  AakaGlkagdvIlavngkpvtslsdllavlallkpgdtvtltvlrggklltltvtlgelp----------
00403191   1/2  AakaGLkagDvIlevngkpvesledlvalla..kpgdtvtltvlrggkeltll-----------------
00459401   1/2  AakaGrLrvGDvIlevngvsveglsheeavallrga..gdtvtLtvlrggklltltvtlgelpidlvs--
00505531   1/2  AaraGLrpgDvIlevngvpveglshleavlllrgagstvtLtvlrggklltl------------------
00505721   1/2  AaraGLrvGDvIlavngvsveglshleavlllkgagdtvtLtvlrggkllt-------------------
00526501   1/2  AakaGrLkpgDvIlevngvsveglshleavlllrgagdtvtLtvlrg-----------------------
00505501   1/2  AaraGrLrvGDvIlevngvsvtglshleavlllkgagdtvtLtvlrdgklltlt----------------
00459041   1/2  pAaraGrLraGDvIlavngvsveglsheeavellrgakpggtvtLtvlrggkeltltvtltrrp------
00498761   1/2  AaraGrLkvGDrIlavngvsveglsheevvellrga..ggtvtLtvlrggklltltvt------------
00443151   1/2  gspAaraGLkvGDvIlevNgvsvegltheeavellks...ggtvtLtvlrggklltllvtlellllllls
00443661   1/2  AaraGrLrvgDvIlevngvsveglsheeavallkga..ggtvtLtvlrggkel-----------------
00403531   1/1  ----------------------------------------------------------------------
00426011   1/2  AaraGLrvGDvIlevngvsvegltheeavellkg..aggtvtLtvlrgg---------------------
00508351   1/2  AakaGLrvgDvIlevngvsvtglslleavlllrgagdtvtLtvlRd------------------------
00489001   1/2  AaraGrLrvGDvIlavngvsveglsheeavellrga..gdtvtLtvlrggkel-----------------
00390281   1/2  AaraGrLkvGDvIlevngksveglshleavlllkkaggtvtLtvlR------------------------
00516431   1/2  AaraGrLrvGDvIlevngvsveglsheeavallkka..ggtvtLlvl-----------------------
00504861   1/2  AaraGLrvGDvIlevngvsveglthleavlllrgagdtvtLtvlrggelltltvtlgelpid--------
00361161   1/1  ----------------------------------------------------------------------
00499461   1/2  gspAaraGrLrvGDvIlevngvsveglsheeavellrga..ggtvtLtvlrggklltltvt---------
00374851   1/2  AakaGLkagDvIlavngvsveglsledvvkllrg.apgdtvtLtvlrggklltltvtlee----------
00446881   1/2  AaraGLrpgDvIlavngvsveglthleavallrgaggtvtLtvlrggkeltl------------------
00443911   1/2  AaraGrLrvGDrIlevngvsvegltheeavallksa..ggtvtLlvlrggkslll---------------
00505841   1/2  pAaraGrLqpGDvIlevngvsvlglsheeavellrgapvggtvtLtvlrggkllt---------------
00505071   1/2  AaragrLrvgDvIlevngvsveglshleavallrgaggtvtLtvlrggklltlt----------------
00422691   1/2  AaragrLrvGDvIlevngvsveglshleavlllkgaggtvtLtvlrggklltltv---------------
00408061   1/2  AaragLkpgDvIlevngvsveglshleavlllkkagdtvtLlvlrgg-----------------------
00381591   1/2  aaragrLkvgDvIlevngvsveglshleavvllkgaggtvtLtvlrggk---------------------
00498781   1/2  AakaGLrvGDvIlevngvsveglsleeavallkg...gdtvtLtvlrggklltlt---------------
00508331   1/2  AakaGLkvGDvIlevngvsvsglsleeavallkg...gdtvtLtvlrggklltltv--------------
00380151   1/2  AaraGLkvgDvIlevngvsvtglthleavlllrgagdtvtLtvlrggelltl------------------
00477311   1/2  aakaGlkvpgdiIlavdGepvsslsdlvrllag.kagdsvtltvlrggklldvvvv--------------
00506181   1/2  AaragLkvgDvIlavngvsveglthleavlllkgagdtvtLtvlrg------------------------
00415551   1/2  aaragLrvgDvilevngvsvlglshleavallkgaggtvtLtvlrgg-----------------------
00497811   1/2  AaraGLrvGDvIlevngvsvegltheevvallkga..ggtvtLtvlrggklltltvtlgel---------
00443981   1/2  AaraGrLrvGDrIlevngvsvegltheeavallksa..ggtvtLlvlrggksll----------------
00352831   1/1  ----------------------------------------------------------------------
00446231   1/2  gglGfslvggldldlgvlvssvlpgspAaraGLkpGDvIlavngvsveglthleavlllkga--------
00522811   1/2  Aa.ggLrvgDvIlevngvpveglshleavallrka..ggtvtLtvlrggkeltl----------------
00504871   1/2  AaragrLrvgDvIlevngvsveglthleavlllrgagdtvtLtvlrgg----------------------
00508361   1/2  AaraGrLrvgDvIlevngvsvegltheeavellrga..ggtvtLtvlr----------------------
00417751   1/2  AaraGLkvgDvIlavngvsvsglshleavlllkgaggtvtLtvlrggk----------------------
00403991   1/2  AaragrLkpgDvIlevngvsveglthleavallkga..ggtvtLtvlrggkel-----------------
00400421   1/2  AaragrLrvgDvIlevngvsveglthleavallkgaggvvtLlvlrggk---------------------
00495211   1/2  AaragrLkvgDvIlevngvsveglshleavlllrgagdtvtLtvlrgg----------------------
00497801   1/2  AakagrLkvgDvIlevngvsvlglslleavlllrgagdtvtLtvlrg-----------------------
00512422   2/2  ----------------------------------------------------------------------
00522701   1/2  AardlggLrvGDrilevngvsvegltheeavellksa..ggtvtLlvlrggklllltl------------
00501141   1/2  AakaGrLrvgDvIlevngvsvrglsheeavellkga..ggtvtLtv------------------------
00404552   2/2  ----------------------------------------------------------------------
00500631   1/2  spAaraGrLrpGDrIlevngvsveglsheeavellkga..ggtvtLtvlrggelllllltle--------
00501161   1/2  AaraGLkvgDrIlevngvsvegltheeavkllkga..ggtvtLtvlrggelllltvtlvrlli-------
00526631   1/2  AakagrLkvgDrIlevngvsveglshleavallkgagdtvtLtvlrdg----------------------
00443991   1/2  aaragLkvgDvIlevngvsveglsheeavdllkglpaggtvtLlvlrggktl------------------
00426871   1/2  AaragrLkvgDvIlevngvsvegltheeavallkga..ggtvtLlvl-----------------------
00403172   2/2  ----------------------------------------------------------------------
00481381   1/2  AaragrLrpgDvilevngvsveglsheeavellkgakleggtvtLtvlrggkl-----------------
00436822   2/2  ----------------------------------------------------------------------
00516031   1/2  AaragrLrvgDvIlevngvsvlglthleavlllkgaggvvtLlvlrggk---------------------
00403192   2/2  ----------------------------------------------------------------------
00453181   1/1  ----------------------------------------------------------------------
00388281   1/2  AaraGrLrvGDrIlevngvsvegltheeavkllkga..ggtvtLtvlrggelllls--------------
00443101   1/2  AaraGrLrpGDrIlevngvsvegltheeavellrga..ggtvtLtvlrggelllls--------------
00508332   2/2  ----------------------------------------------------------------------
00527271   1/2  AaragrLkvgDvIlavngvsveglsheeavallrga..ggtvtLt-------------------------
00412431   1/2  aaragrLrvgDrIlevngvsvegltheeavellrga..ggtvtLtvlrdgelll----------------
00412461   1/2  aa.ggLrvGDrIlevngvsveglsheeavallksa..ggtvtLlvlrd----------------------
00500572   2/2  ----------------------------------------------------------------------
00428441   1/2  AaragrLrvgDrIlevngvsvegltheeavallkga..ggtvtLlvlrd---------------------
00505161   1/2  AaraGrLrvGDrIlevNgvsvegltheeavellkgaklleakkggtv-----------------------
00443371   1/2  AaragrLrvgDvilevngvsvlgltheeavellkea..ggtvtLlvlrggkllllslk------------
00505532   2/2  --------------------------------------------------------gldgisfaipidla
00505502   2/2  ------------------------------------------------------------------ldge
00504921   1/2  AaraGrLrvGDrIlevNgvsveglsheeavellkgaplggtvtLlvlrpge.------------------
00520771   1/2  AakagrLrvgDrIlevngvsvegltheeavellkga..ggtvtLlvlr----------------------
00408581   1/1  ----------------------------------------------------------------------
00443112   2/2  ----------------------------------------------------------------------
00374852   2/2  ----------------------------------------------------------------------
00498762   2/2  ----------------------------------------------------------------------
00499462   2/2  ---------------------------------------------------------------yldgevi
00443662   2/2  ----------------------------------------------------------------------
00380152   2/2  ----------------------------------------------------------------------
00421161   1/2  AaragrLrvGDrilevngvsveglsheeavallkga..ggtvtLtvlr----------------------
00508571   1/2  AaragrLrvgDrIlevngvsvegltheeavellrga..ggtvtLtvlrggklllllltl-----------
00505722   2/2  --------------------------------------------------------gllgigfaipinla
00505411   1/2  vvllkkgggglGfsivggkdlggdlgifvssvlpgspAakaGrLrvGD----------------------
00498782   2/2  ---------------------------------------------------------------slllskl
00446232   2/2  ----------------------------------------------------------------------
00459042   2/2  ----------------------------------------------------------------------
00508362   2/2  ----------------------------------------------------------------------
00434102   2/2  ----------------------------------------------------------------------
00422692   2/2  ----------------------------------------------------------------------
00505842   2/2  -------------------------------------------------------------lldaiigsl
00446882   2/2  ----------------------------------------------------------------------
00526502   2/2  ----------------------------------------------------------------------
00380591   1/1  ----------------------------------------------------------------------
00459402   2/2  ----------------------------------------------------------------------
00446381   1/2  dsllg........gifvssvlpggpAardGrLrvGDeIlevNgvsv------------------------
00443152   2/2  ----------------------------------------------------------------------
00522812   2/2  ----------------------------------------------------------------------
00402941   1/2  pggpaaraglLrvgDrIlevngvsvlgltheeavellkga..ggtvtL----------------------
00413572   2/2  ----------------------------------------------------------------------
00417752   2/2  ----------------------------------------------------------------------
00495212   2/2  ----------------------------------------------------------------------
00497812   2/2  ----------------------------------------------------------------------
00426012   2/2  ----------------------------------------------------------------------
00505741   1/2  AaragrLkpgDrIlevngvsvvglsheeavellkga..ggtvtLtvl-----------------------
00501162   2/2  ----------------------------------------------------------------------
00489002   2/2  ----------------------------------------------------------------------
00388282   2/2  ----------------------------------------------------------------------
00443912   2/2  ----------------------------------------------------------------------
00500632   2/2  ----------------------------------------------------------------------
00403992   2/2  ----------------------------------------------------------------------
00508572   2/2  ----------------------------------------------------------------------
00481382   2/2  ----------------------------------------------------------------------
00477312   2/2  ----------------------------------------------------------------------
00381592   2/2  ----------------------------------------------------------------------
00408062   2/2  ----------------------------------------------------------------------
00443102   2/2  ----------------------------------------------------------------------
00522702   2/2  ----------------------------------------------------------------------
00505162   2/2  ----------------------------------------------------------------------
00505412   2/2  ----------------------------------------------------------------------
00390282   2/2  ----------------------------------------------------------------------
00516432   2/2  ----------------------------------------------------------------------
00400422   2/2  ----------------------------------------------------------------------
00505072   2/2  ----------------------------------------------------------------------
00504872   2/2  ----------------------------------------------------------------------
00508352   2/2  ----------------------------------------------------------------------
00501142   2/2  ----------------------------------------------------------------------
00443372   2/2  ----------------------------------------------------------------------
00497802   2/2  ----------------------------------------------------------------------
00412462   2/2  ----------------------------------------------------------------------
00499481   1/2  erlvvllkkgggglGfslvggkddggifvssvlpggpAaraGrLrvG-----------------------
00443982   2/2  ----------------------------------------------------------------------
00443992   2/2  ----------------------------------------------------------------------
00504862   2/2  ----------------------------------------------------------------------
00446382   2/2  ----------------------------------------------------------------------
00506182   2/2  ----------------------------------------------------------------------
00412432   2/2  ----------------------------------------------------------------------
00415552   2/2  ----------------------------------------------------------------------
00426872   2/2  ----------------------------------------------------------------------
00526632   2/2  ----------------------------------------------------------------------
00421162   2/2  ----------------------------------------------------------------------
00499482   2/2  ----------------------------------------------------------------------
00516032   2/2  ----------------------------------------------------------------------
00504922   2/2  ----------------------------------------------------------------------
00505742   2/2  ----------------------------------------------------------------------
00527272   2/2  ----------------------------------------------------------------------
00520772   2/2  ----------------------------------------------------------------------
00378401   1/1  ----------------------------------------------------------------------
00428442   2/2  ----------------------------------------------------------------------
00402942   2/2  ----------------------------------------------------------------------
00377861   1/1  ----------------------------------------------------------------------
00371311   1/1  ----------------------------------------------------------------------
00424161   1/1  ----------------------------------------------------------------------
00443821   1/2  AeraGLrvGDqilevNgvdlegatheeavellkn..agdevtllvqrrpdllelillsrsgps-------
00443822   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GDNGNSSSRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDV
00490341   1/1  ----------------------------------------------------------------------
00403511   1/1  ----------------------------------------------------------------------
00436831   1/1  ----------------------------------------------------------------------
00488771   1/1  ----------------------------------------------------------------------
00415371   1/1  ----------------------------------------------------------------------
00479071   1/1  ----------------------------------------------------------------------
00481331   1/1  ----------------------------------------------------------------------
00350421   1/1  ----------------------------------------------------------------------
00490101   1/1  ----------------------------------------------------------------------
00430391   1/1  ----------------------------------------------------------------------
00512431   1/1  ----------------------------------------------------------------------
00361541   1/1  ----------------------------------------------------------------------
00532991   1/1  ----------------------------------------------------------------------
00355001   1/1  ----------------------------------------------------------------------
00479571   1/1  ----------------------------------------------------------------------
00527371   1/1  ----------------------------------------------------------------------
00533001   1/1  ----------------------------------------------------------------------
00472181   1/1  ----------------------------------------------------------------------
00501391   1/1  ----------------------------------------------------------------------
00436031   1/1  ----------------------------------------------------------------------
00421341   1/1  ----------------------------------------------------------------------
00404551   1/2  ----------------------------------------------------------------------
00434101   1/2  ----------------------------------------------------------------------
00443111   1/2  ----------------------------------------------------------------------
00500571   1/2  ----------------------------------------------------------------------
00436821   1/2  ----------------------------------------------------------------------
00351821   1/1  ----------------------------------------------------------------------
00403171   1/2  ----------------------------------------------------------------------
00413571   1/2  ----------------------------------------------------------------------
00385121   1/1  ----------------------------------------------------------------------
00512421   1/2  ----------------------------------------------------------------------
00403191   1/2  ----------------------------------------------------------------------
00459401   1/2  ----------------------------------------------------------------------
00505531   1/2  ----------------------------------------------------------------------
00505721   1/2  ----------------------------------------------------------------------
00526501   1/2  ----------------------------------------------------------------------
00505501   1/2  ----------------------------------------------------------------------
00459041   1/2  ----------------------------------------------------------------------
00498761   1/2  ----------------------------------------------------------------------
00443151   1/2  s---------------------------------------------------------------------
00443661   1/2  ----------------------------------------------------------------------
00403531   1/1  ----------------------------------------------------------------------
00426011   1/2  ----------------------------------------------------------------------
00508351   1/2  ----------------------------------------------------------------------
00489001   1/2  ----------------------------------------------------------------------
00390281   1/2  ----------------------------------------------------------------------
00516431   1/2  ----------------------------------------------------------------------
00504861   1/2  ----------------------------------------------------------------------
00361161   1/1  ----------------------------------------------------------------------
00499461   1/2  ----------------------------------------------------------------------
00374851   1/2  ----------------------------------------------------------------------
00446881   1/2  ----------------------------------------------------------------------
00443911   1/2  ----------------------------------------------------------------------
00505841   1/2  ----------------------------------------------------------------------
00505071   1/2  ----------------------------------------------------------------------
00422691   1/2  ----------------------------------------------------------------------
00408061   1/2  ----------------------------------------------------------------------
00381591   1/2  ----------------------------------------------------------------------
00498781   1/2  ----------------------------------------------------------------------
00508331   1/2  ----------------------------------------------------------------------
00380151   1/2  ----------------------------------------------------------------------
00477311   1/2  ----------------------------------------------------------------------
00506181   1/2  ----------------------------------------------------------------------
00415551   1/2  ----------------------------------------------------------------------
00497811   1/2  ----------------------------------------------------------------------
00443981   1/2  ----------------------------------------------------------------------
00352831   1/1  ----------------------------------------------------------------------
00446231   1/2  ----------------------------------------------------------------------
00522811   1/2  ----------------------------------------------------------------------
00504871   1/2  ----------------------------------------------------------------------
00508361   1/2  ----------------------------------------------------------------------
00417751   1/2  ----------------------------------------------------------------------
00403991   1/2  ----------------------------------------------------------------------
00400421   1/2  ----------------------------------------------------------------------
00495211   1/2  ----------------------------------------------------------------------
00497801   1/2  ----------------------------------------------------------------------
00512422   2/2  -----------ergllGlglvlltde.....ggvvvvsvlpgspAakaGlkagdvIlavngkpvtslsdl
00522701   1/2  ----------------------------------------------------------------------
00501141   1/2  ----------------------------------------------------------------------
00404552   2/2  ------------rpllGvllldltpelaeelgllllllldvllgvlvlsvlpgspAakaGLkpgDvIlav
00500631   1/2  ----------------------------------------------------------------------
00501161   1/2  ----------------------------------------------------------------------
00526631   1/2  ----------------------------------------------------------------------
00443991   1/2  ----------------------------------------------------------------------
00426871   1/2  ----------------------------------------------------------------------
00403172   2/2  ----------vagpllGislagltdllafllgldvdkgvvvssvlpgspAakaGLkagDvIlavngvpvt
00481381   1/2  ----------------------------------------------------------------------
00436822   2/2  -----------agpglGfslagltdelafllgldgdkgvvvtsvlpgspAakaGLkpgDvIlavngkpve
00516031   1/2  ----------------------------------------------------------------------
00403192   2/2  -------rgllgvllqdltlllalllgldldkgvlvtsvlpgspAakaGLkagDvIlevngkpvesledl
00453181   1/1  ----------------------------------------------------------------------
00388281   1/2  ----------------------------------------------------------------------
00443101   1/2  ----------------------------------------------------------------------
00508332   2/2  ---------------lGfsivggld....ldlgvvvssvlpgspAakaGLkvGDvIlevngvsvsgl.sl
00527271   1/2  ----------------------------------------------------------------------
00412431   1/2  ----------------------------------------------------------------------
00412461   1/2  ----------------------------------------------------------------------
00500572   2/2  -------------gglGfslvggtdlglegdggvvvssvlpgspAaraGrLrvGDrIlavngvsveglth
00428441   1/2  ----------------------------------------------------------------------
00505161   1/2  ----------------------------------------------------------------------
00443371   1/2  ----------------------------------------------------------------------
00505532   2/2  elvlvtllkgg..gglGfslvg........gggvlvssvlpgspAaraGLrpgDvIlevngvpveglshl
00505502   2/2  vigirtvilsksggglGfaivggldlllgleldggvvvssvlpgspAaraGrLrvGDvIlevngvsvtgl
00504921   1/2  ----------------------------------------------------------------------
00520771   1/2  ----------------------------------------------------------------------
00408581   1/1  ----------------------------------------------------------------------
00443112   2/2  ---------------lGfslvggld....gdlgvvvssvlpggpAakaGrLkvGDvIlevngvsveglth
00374852   2/2  ---------kgglgglgfaivggl....dvdlgvvvasvlpgspAakaGLkagDvIlavngvsveglsle
00498762   2/2  ---------------lGfsivggtdllllglllllgvvvssvlpgspAaraGrLkvGDrIlavngvsveg
00499462   2/2  girtvilsksgg..glGfsivggldl.llgdggvvvssvlpgspAaraGrLrvGDvIlevngvsveglsh
00443662   2/2  -------------gglGfslvggtdllaeslglgdlgvvvssvlpgspAaraGrLrvgDvIlevngvsve
00380152   2/2  -----------grgglGfslvggtd.....dlgvvvssvlpgspAaraGLkvgDvIlevngvsvtglthl
00421161   1/2  ----------------------------------------------------------------------
00508571   1/2  ----------------------------------------------------------------------
00505722   2/2  klvlvtlikgg.rgglGfslvggtde....dggvlvssvlpgspAaraGLrvGDvIlavngvsveglshl
00505411   1/2  ----------------------------------------------------------------------
00498782   2/2  elvrlivllkgglgglgfaivggld....ldggvvvssvlpgspAakaGLrvGDvIlevngvsvegl.sl
00446232   2/2  ------------------------------gaaellvvllkkgggglGfslvggldldlgvlvssvlpgs
00459042   2/2  -------------nlllelldprtvilskgelgglGfsivggkd.....dggvvvssvlpggpAaraGrL
00508362   2/2  -----------eggglGlslvggtdlgleldlgvvvssvlpgspAaraGrLrvgDvIlevngvsveglth
00434102   2/2  ---------------lGfslvggtdelaeslglegdlgifvssvlpggpAaraGrLrvGDrIlevngvsv
00422692   2/2  -------------gglGfslvggtd.....dggvlvssvlpgspAaragrLrvGDvIlevngvsveglsh
00505842   2/2  nslgdplslllspilelevltvtlvkgpgglGfsivggdd.......gifvssvlpggpAaraGrLqpGD
00446882   2/2  -----------llgivllvvllkgglgglgfaivggldldlgvvvssvlpgspAaraGLrpgDvIlavng
00526502   2/2  -----------ergglGislvggtdelaealglegdggvlvasvlpgspAakaGrLkpgDvIlevngvsv
00380591   1/1  ----------------------------------------------------------------------
00459402   2/2  ---------------lGfgi.....vggkddggvlvssvlpgspAakaGrLrvGDvIlevngvsveglsh
00446381   1/2  ----------------------------------------------------------------------
00443152   2/2  -----slgigfaipislalpvlellvrlvelvkgpggglGfslvggld....sglgifvssvlpgspAar
00522812   2/2  --------------glGfslvggtdsllgldgdlgvvvssvlpggpAa.ggLrvgDvIlevngvpvegls
00402941   1/2  ----------------------------------------------------------------------
00413572   2/2  ---------------lGfslvggtdelalalglegdlgifvssvlpggpAaraGrLrvGDvIlevngvsv
00417752   2/2  -----------ergglGftlvggtd.......gvvvssvlpgspAaraGLkvgDvIlavngvsvsglshl
00495212   2/2  -----------grgglGlslvggtdll.lgdggvvvssvlpgspAaragrLkvgDvIlevngvsveglsh
00497812   2/2  --------------glGfsiv...........gvvvssvlpgspAaraGLrvGDvIlevngvsveglthe
00426012   2/2  ---------------lgfaivgglalpvllalllllegdggvvvssvlpgspAaraGLrvGDvIlevngv
00505741   1/2  ----------------------------------------------------------------------
00501162   2/2  ---------------lGfslv........ggdgvfvssvlpgspAaraGLkvgDrIlevngvsveglthe
00489002   2/2  -------------gglGlslvggtdelaeslgledggvvvssvlpgspAaraGrLrvGDvIlavngvsve
00388282   2/2  ---------------lGfsivggkdsll.gdggifvssvlpggpAaraGrLrvGDrIlevngvsveglth
00443912   2/2  ---------------lGfslvggkdslglegdlgifvssvlpggpAaraGrLrvGDrIlevngvsveglt
00500632   2/2  ---------------lGfslvgglds...gdggvfvssvlpgspAaraGrLrpGDrIlevngvsveglsh
00403992   2/2  -evrlvelgkgsrgglGfslvggtde..egdggvlvssvlpgspAaragrLkpgDvIlevngvsveglth
00508572   2/2  ---------------lGfslvggldl...gdggifvssvlpggpAaragrLrvgDrIlevngvsveglth
00481382   2/2  ----lvvllkkgggglGlslvggldl..egdggvfvssvlpgspAaragrLrpgDvilevngvsveglsh
00477312   2/2  -------------GlLgadleld.......gggvvvasvlpgdvsnpnlksPaakaGlkvpgdiIlavdG
00381592   2/2  ---------------lGfslvggtdl.legdggvlvssvlpgspaaragrLkvgDvIlevngvsveglsh
00408062   2/2  --------sgeviginlvivllskgseglGfsilggkddlgvfvssvlpgspAaragLkpgDvIlevngv
00443102   2/2  ---------------lGfslvggkd....gdlgivvssvlpggpAaraGrLrpGDrIlevngvsveglth
00522702   2/2  ---------------lGfslvg.....gldsdlgvfvssvlpgspAardlggLrvGDrilevngvsvegl
00505162   2/2  ---------------lGfsivggkdsplegdlgifvssvlpggpAaraGrLrvGDrIlevNgvsveglth
00505412   2/2  ---------------gaaglellllllallsplegevvvvllkkgggglGfsivggkd..lggdlgifvs
00390282   2/2  -----------ergglGfslvggtpellllegdlgvvvssvlpgspAaraGrLkvGDvIlevngksvegl
00516432   2/2  ---------------lGfsivggtds.llgdlgifvssvlpgspAaraGrLrvGDvIlevngvsveglsh
00400422   2/2  evrtvtllkggg..glGfslvggadlllldgdlgvfvssvlpggpAaragrLrvgDvIlevngvsveglt
00505072   2/2  ---------------lGfsivggld....gdggvvvssvlpgspAaragrLrvgDvIlevngvsveglsh
00504872   2/2  ---------------lGlsivggtdelalslgdggvfvssvlpggpAaragrLrvgDvIlevngvsvegl
00508352   2/2  -------------gglGislvgltdellllegdggvlvssvlpgspAakaGLrvgDvIlevngvsvtgls
00501142   2/2  -----------elgglGfslvggkd.......gvvvssvlpgspAakaGrLrvgDvIlevngvsvrglsh
00443372   2/2  ---------------lGfslvggkds...gdlgifvssvlpggpAaragrLrvgDvilevngvsvlglth
00497802   2/2  ---llvvllkksggglGlslvggtg..leldggvvvssvlpgspAakagrLkvgDvIlevngvsvlglsl
00412462   2/2  ---------------lGfslvggkdslglslllgdlgifvssvlpggpaa.ggLrvGDrIlevngvsveg
00499481   1/2  ----------------------------------------------------------------------
00443982   2/2  ---------------lGfslvggkdslagalgldldlgifvssvlpggpAaraGrLrvGDrIlevngvsv
00443992   2/2  ---------------lGfslvgg.........gvlvssvlpgspaaragLkvgDvIlevngvsveglshe
00504862   2/2  --------------------------------gvvvssvlpgspAaraGLrvGDvIlevngvsveglthl
00446382   2/2  --------------gaelllslldllllpgevrlvtlvkdggglGfslvggvdsllg...gifvssvlpg
00506182   2/2  ---------glllgllllvvllkggggglGfsivggldldlgvvvssvlpgspAaragLkvgDvIlavng
00412432   2/2  ---------------lGfslvggld....gdggvvvssvlpgspaaragrLrvgDrIlevngvsveglth
00415552   2/2  ---------------lgfslv...........gvvvtsvlpgspaaragLrvgDvilevngvsvlglshl
00426872   2/2  ---------------lGfslvggld....gdlgvvvssvlpgspAaragrLkvgDvIlevngvsveglth
00526632   2/2  ---------------lGfslvggadsllllldggvvvssvlpgspAakagrLkvgDrIlevngvsvegls
00421162   2/2  ---------------lGfsivggld..legdlgivvssvlpgspAaragrLrvGDrilevngvsveglsh
00499482   2/2  ---------------gaaasellllllegerlvvllkkgggglGfslvggkd.....dggifvssvlpgg
00516032   2/2  elrtvtlvkggg..glGfsivggadsllllldlgvlvssvlpggpAaragrLrvgDvIlevngvsvlglt
00504922   2/2  ---------------lGfslvggkds.plgdlgifvssvlpggpAaraGrLrvGDrIlevNgvsveglsh
00505742   2/2  ---------------lGfslvggldl..glllgifvssvlpggpAaragrLkpgDrIlevngvsvvglsh
00527272   2/2  ---------------lGfslvggtdll.sldggvvvssvlpgspAaragrLkvgDvIlavngvsveglsh
00520772   2/2  ---------------lGfslvggadslllegdggifvssvlpggpAakagrLrvgDrIlevngvsveglt
00378401   1/1  ----------------------------------------------------------------------
00428442   2/2  ---------------lGfslvggadslllegdlgvvvssvlpgspAaragrLrvgDrIlevngvsveglt
00402942   2/2  -evrlvtlvkdsggglGfslvggkdg......gifvssvlpggpaaraglLrvgDrIlevngvsvlglth
00377861   1/1  ----------------------------------------------------------------------
00371311   1/1  ----------------------------------------------------------------------
00424161   1/1  ----------------------------------------------------------------------
00443821   1/2  ----------------------------------------------------------------------
00443822   2/2  ------------------------sivggedggifvskvlpgspAeraGLrvGDqilevNgvdleg----


                         *         -         -         -         -         +         -:560
query           REAINTAKADNKNSVLIRVRSGGSSRFVAVPISAKG----------------------------------
00490341   1/1  ----------------------------------------------------------------------
00403511   1/1  ----------------------------------------------------------------------
00436831   1/1  ----------------------------------------------------------------------
00488771   1/1  ----------------------------------------------------------------------
00415371   1/1  ----------------------------------------------------------------------
00479071   1/1  ----------------------------------------------------------------------
00481331   1/1  ----------------------------------------------------------------------
00350421   1/1  ----------------------------------------------------------------------
00490101   1/1  ----------------------------------------------------------------------
00430391   1/1  ----------------------------------------------------------------------
00512431   1/1  ----------------------------------------------------------------------
00361541   1/1  ----------------------------------------------------------------------
00532991   1/1  ----------------------------------------------------------------------
00355001   1/1  ----------------------------------------------------------------------
00479571   1/1  ----------------------------------------------------------------------
00527371   1/1  ----------------------------------------------------------------------
00533001   1/1  ----------------------------------------------------------------------
00472181   1/1  ----------------------------------------------------------------------
00501391   1/1  ----------------------------------------------------------------------
00436031   1/1  ----------------------------------------------------------------------
00421341   1/1  ----------------------------------------------------------------------
00404551   1/2  ----------------------------------------------------------------------
00434101   1/2  ----------------------------------------------------------------------
00443111   1/2  ----------------------------------------------------------------------
00500571   1/2  ----------------------------------------------------------------------
00436821   1/2  ----------------------------------------------------------------------
00351821   1/1  ----------------------------------------------------------------------
00403171   1/2  ----------------------------------------------------------------------
00413571   1/2  ----------------------------------------------------------------------
00385121   1/1  ----------------------------------------------------------------------
00512421   1/2  ----------------------------------------------------------------------
00403191   1/2  ----------------------------------------------------------------------
00459401   1/2  ----------------------------------------------------------------------
00505531   1/2  ----------------------------------------------------------------------
00505721   1/2  ----------------------------------------------------------------------
00526501   1/2  ----------------------------------------------------------------------
00505501   1/2  ----------------------------------------------------------------------
00459041   1/2  ----------------------------------------------------------------------
00498761   1/2  ----------------------------------------------------------------------
00443151   1/2  ----------------------------------------------------------------------
00443661   1/2  ----------------------------------------------------------------------
00403531   1/1  ----------------------------------------------------------------------
00426011   1/2  ----------------------------------------------------------------------
00508351   1/2  ----------------------------------------------------------------------
00489001   1/2  ----------------------------------------------------------------------
00390281   1/2  ----------------------------------------------------------------------
00516431   1/2  ----------------------------------------------------------------------
00504861   1/2  ----------------------------------------------------------------------
00361161   1/1  ----------------------------------------------------------------------
00499461   1/2  ----------------------------------------------------------------------
00374851   1/2  ----------------------------------------------------------------------
00446881   1/2  ----------------------------------------------------------------------
00443911   1/2  ----------------------------------------------------------------------
00505841   1/2  ----------------------------------------------------------------------
00505071   1/2  ----------------------------------------------------------------------
00422691   1/2  ----------------------------------------------------------------------
00408061   1/2  ----------------------------------------------------------------------
00381591   1/2  ----------------------------------------------------------------------
00498781   1/2  ----------------------------------------------------------------------
00508331   1/2  ----------------------------------------------------------------------
00380151   1/2  ----------------------------------------------------------------------
00477311   1/2  ----------------------------------------------------------------------
00506181   1/2  ----------------------------------------------------------------------
00415551   1/2  ----------------------------------------------------------------------
00497811   1/2  ----------------------------------------------------------------------
00443981   1/2  ----------------------------------------------------------------------
00352831   1/1  ----------------------------------------------------------------------
00446231   1/2  ----------------------------------------------------------------------
00522811   1/2  ----------------------------------------------------------------------
00504871   1/2  ----------------------------------------------------------------------
00508361   1/2  ----------------------------------------------------------------------
00417751   1/2  ----------------------------------------------------------------------
00403991   1/2  ----------------------------------------------------------------------
00400421   1/2  ----------------------------------------------------------------------
00495211   1/2  ----------------------------------------------------------------------
00497801   1/2  ----------------------------------------------------------------------
00512422   2/2  lavl..allkpgdtvtltvlrggklltltvtlgelp----------------------------------
00522701   1/2  ----------------------------------------------------------------------
00501141   1/2  ----------------------------------------------------------------------
00404552   2/2  ngkpvesledlvkll...k..pgdtvtltvlRggel----------------------------------
00500631   1/2  ----------------------------------------------------------------------
00501161   1/2  ----------------------------------------------------------------------
00526631   1/2  ----------------------------------------------------------------------
00443991   1/2  ----------------------------------------------------------------------
00426871   1/2  ----------------------------------------------------------------------
00403172   2/2  gltdleavlllkk..agdtvtLtvlrggkll---------------------------------------
00481381   1/2  ----------------------------------------------------------------------
00436822   2/2  glsdleavlllkk..pgdtvtltvlrggklltltvtl---------------------------------
00516031   1/2  ----------------------------------------------------------------------
00403192   2/2  valla....kpgdtvtltvlrggkeltll-----------------------------------------
00453181   1/1  ----------------------------------------------------------------------
00388281   1/2  ----------------------------------------------------------------------
00443101   1/2  ----------------------------------------------------------------------
00508332   2/2  eeavallkg..gdtvtLtvlrggklltltvtl--------------------------------------
00527271   1/2  ----------------------------------------------------------------------
00412431   1/2  ----------------------------------------------------------------------
00412461   1/2  ----------------------------------------------------------------------
00500572   2/2  eeavellrga....ggtvtLtvlrdgklltvtltld----------------------------------
00428441   1/2  ----------------------------------------------------------------------
00505161   1/2  ----------------------------------------------------------------------
00443371   1/2  ----------------------------------------------------------------------
00505532   2/2  eavlllrga..gstvtLtvlrggklltl------------------------------------------
00505502   2/2  shleavlllkga..gdtvtLtvlrdgkllt----------------------------------------
00504921   1/2  ----------------------------------------------------------------------
00520771   1/2  ----------------------------------------------------------------------
00408581   1/1  ----------------------------------------------------------------------
00443112   2/2  eeavkllkgap..vggtvtLtvlrggklltltvt------------------------------------
00374852   2/2  dvvkllrgap...gdtvtLtvlrggklltltvtlee----------------------------------
00498762   2/2  lsheevvellrga....ggtvtLtvlrggklltl------------------------------------
00499462   2/2  eeavellrga....ggtvtLtvlrggklltltvt------------------------------------
00443662   2/2  glsheeavallkga....ggtvtLtvlrg-----------------------------------------
00380152   2/2  eavlllrga..gdtvtLtvlrggelltl------------------------------------------
00421161   1/2  ----------------------------------------------------------------------
00508571   1/2  ----------------------------------------------------------------------
00505722   2/2  eavlllkga..gdtvtLtvlrggkllt-------------------------------------------
00505411   1/2  ----------------------------------------------------------------------
00498782   2/2  eeavallkg..gdtvtLtvlrggklltltvt---------------------------------------
00446232   2/2  pAaraGLkpGDvIlavngvsveglthleavlllkga..--------------------------------
00459042   2/2  raGDvIlavngvsveglsheeavellrga..k--------------------------------------
00508362   2/2  eeavellrga....ggtvtLtvlr----------------------------------------------
00434102   2/2  egltheeavellkga....ggtvtL---------------------------------------------
00422692   2/2  leavlllkga..ggtvtLtvlrggklltltv---------------------------------------
00505842   2/2  vIlevngvsvlglsheeavellrgap..vgg---------------------------------------
00446882   2/2  vsveglthleavallrga....ggtvtL------------------------------------------
00526502   2/2  eglshleavlllrga..gdtvtL-----------------------------------------------
00380591   1/1  ----------------------------------------------------------------------
00459402   2/2  eeavallrga....gdtvtLtvlrggklltltvt------------------------------------
00446381   1/2  ----------------------------------------------------------------------
00443152   2/2  aGLkvGDvIlevNgvsvegltheeavellks.--------------------------------------
00522812   2/2  hleavallrka....ggtvtLtvlrggkel----------------------------------------
00402941   1/2  ----------------------------------------------------------------------
00413572   2/2  eglsheeavallkga....ggtv-----------------------------------------------
00417752   2/2  eavlllkga..ggtvtLtvlrggk----------------------------------------------
00495212   2/2  leavlllrga..gdtvtLtvlrgg----------------------------------------------
00497812   2/2  evvallkga....ggtvtLtvlrggklltltvtlgel---------------------------------
00426012   2/2  svegltheeavellkga....gg-----------------------------------------------
00505741   1/2  ----------------------------------------------------------------------
00501162   2/2  eavkllkga....ggtvtLtvlrggelllltvt-------------------------------------
00489002   2/2  glsheeavellrga....gdtvtLtvlrg-----------------------------------------
00388282   2/2  eeavkllkga....ggtvtLtvlrggellllsvtll----------------------------------
00443912   2/2  heeavallksa....ggtvtLlvlrggksll---------------------------------------
00500632   2/2  eeavellkga....ggtvtLtvlrggellllll-------------------------------------
00403992   2/2  leavallkga..ggtvtLtvlrggkeltl-----------------------------------------
00508572   2/2  eeavellrga....ggtvtLtvlrggklllllltl-----------------------------------
00481382   2/2  eeavellkgakleggtvtLtvlrggkll------------------------------------------
00477312   2/2  epvsslsdlvrllag...kagdsvtltvlrggkll-----------------------------------
00381592   2/2  leavvllkga..ggtvtLtvlrggk---------------------------------------------
00408062   2/2  sveglshleavlllkka..gdtv-----------------------------------------------
00443102   2/2  eeavellrga....ggtvtLtvlrggelllls--------------------------------------
00522702   2/2  theeavellksa....ggtvtLlvlrggkllllt------------------------------------
00505162   2/2  eeavellkgaklleakkggtvtLv----------------------------------------------
00505412   2/2  svlpgspAakaGrLrvGDrIle------------------------------------------------
00390282   2/2  shleavlllkka..ggtvtLtv------------------------------------------------
00516432   2/2  eeavallkka....ggtvtLlvl-----------------------------------------------
00400422   2/2  hleavallkga..ggvvtLlvlrg----------------------------------------------
00505072   2/2  leavallrga..ggtvtLtvlrggklltlt----------------------------------------
00504872   2/2  thleavlllrga..gdtvtLtvlr----------------------------------------------
00508352   2/2  lleavlllrga.gdtvtLtvl-------------------------------------------------
00501142   2/2  eeavellkga....ggtvtLtv------------------------------------------------
00443372   2/2  eeavellkea....ggtvtLlvlrggkllllslk------------------------------------
00497802   2/2  leavlllrga..gdtvtLtvlrg-----------------------------------------------
00412462   2/2  lsheeavallksa....ggtvtLl----------------------------------------------
00499481   1/2  ----------------------------------------------------------------------
00443982   2/2  egltheeavallksa....ggtvtLlvlrg----------------------------------------
00443992   2/2  eavdllkglp..aggtvtLlvlrggktl------------------------------------------
00504862   2/2  eavlllrga..gdtvtLtvlrggelltltvtlge------------------------------------
00446382   2/2  gpAardGrLrvGDeIlevNgvs------------------------------------------------
00506182   2/2  vsveglthleavlllkga..gd------------------------------------------------
00412432   2/2  eeavellrga....ggtvtLtvlrdgelll----------------------------------------
00415552   2/2  eavallkga..ggtvtLtvlrgg-----------------------------------------------
00426872   2/2  eeavallkga....ggtvtLlvl-----------------------------------------------
00526632   2/2  hleavallkga..gdtvtLtvlrd----------------------------------------------
00421162   2/2  eeavallkga....ggtvtLtvlr----------------------------------------------
00499482   2/2  pAaraGrLrvGDrIlevNgvsvegl.theeavellk----------------------------------
00516032   2/2  hleavlllkga..ggvvtLlvlrg----------------------------------------------
00504922   2/2  eeavellkgapl..ggtvtLlvlrpge-------------------------------------------
00505742   2/2  eeavellkga....ggtvtLtvlrg---------------------------------------------
00527272   2/2  eeavallrga....ggtvtLt-------------------------------------------------
00520772   2/2  heeavellkga....ggtvtLlvl----------------------------------------------
00378401   1/1  ----------------------------------------------------------------------
00428442   2/2  heeavallkga....ggtvtLlvl----------------------------------------------
00402942   2/2  eeavellkga....ggtvtLlvlr----------------------------------------------
00377861   1/1  ----------------------------------------------------------------------
00371311   1/1  ----------------------------------------------------------------------
00424161   1/1  ----------------------------------------------------------------------
00443821   1/2  ----------------------------------------------------------------------
00443822   2/2  ----------------------------------------------------------------------