[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39379.1


[Show Plain Result]

## Summary of Sequence Search
   1::1070
 826::1056 5.6e-55 41.0% 0039249 00392492 2/2   drug efflux transporter AcrB transmembr 
 852::1051 3.8e-43 35.9% 0039248 00392482 2/2   drug efflux transporter AcrB transmembr 
 299::508  5.3e-31 31.8% 0039248 00392481 1/2   drug efflux transporter AcrB transmembr 
  42::127    3e-22 40.7% 0047456 00474561 1/2   drug efflux transporter AcrB pore domai 
 154::333  3.2e-19 37.9% 0047457 00474572 2/2   drug efflux transporter AcrB pore domai 
 272::513  4.6e-19 24.4% 0039249 00392491 1/2   drug efflux transporter AcrB transmembr 
 192::276  2.2e-18 35.3% 0039247 00392471 1/2   drug efflux transporter AcrB TolC docki 
 192::276  4.3e-18 30.6% 0039246 00392461 1/2   drug efflux transporter AcrB TolC docki 
 725::831  3.5e-12 31.8% 0039246 00392462 2/2   drug efflux transporter AcrB TolC docki 
 725::831  2.9e-11 34.1% 0039247 00392472 2/2   drug efflux transporter AcrB TolC docki 
 566::672  0.00019 18.3% 0047458 00474581 1/1   drug efflux transporter AcrB pore domai 
 293::333       45 22.0% 0047456 00474562 2/2   drug efflux transporter AcrB pore domai 
  93::134       84 19.0% 0047457 00474571 1/2   drug efflux transporter AcrB pore domai 
   1::1070


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIEKLLAFSVRQRWLVMIGVLMMAAFGAWNFTRLPIDAVPDITNVQVQINTNAPGYSPLEVEQRITFPIE
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  -----------------------------------------itipvvvvtttypGaspeeveelvtlplE
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDILPVGIETAMGPVSTGLGEIY
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ealsgvegvkyirStssseglsvitvefelgtdldlalvevrnkvnaalssLPegve-------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------lavllqpganalevaeavkalleelekslPegvelvivyDrt------


                         +         -         -         -         -         *         -:210
query           MYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAGVNEVNTIGGFEKQFHVLPDPARLMAYRLSF
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  -------------tsdgldllelrdyadlvlrdeLlrvpgVgevqlfGgqe...................
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ---------------------------------------------------pqlrveldrdklaalglsl
00392461   1/2  ---------------------------------------------------pqlrveldpdklaalgltl
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RDVMTSLASNNANVGAGYIEKNGEQYLVRTPGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTG
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ..................................................................dyrl
00392491   1/2  -------------------------------------------------------------idlvlgpsl
00392471   1/2  sdvasalqaanggvpvgtlleggreylvrvqadpglrlspedlenlvvrtadgalvpLsdvAtvel----
00392461   1/2  sdvanalqaanvqvlggllvgtfllggreyevvvradglrlspedlenlvvrtnadgslvpLsdvA----
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AATVSGKEVVLGTAMLLIGENGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEG
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ------------------gantgevvdavrallee...alpagvtvevtgvsadlieeaisdlllallla
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  larlngkpavglavllqpganalevaeavkalleelekslPegvelvivyDrt-----------------
00392491   1/2  isrengkravlvrvnlrggdltse..eavalalallagalpagvsvevggdleeq..........allla
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ------------tvefelgtdldlalvevrnkvnaalssLPegvepplvlkld-----------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ALLVIAILFLILGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGAIDFGIIIDGAVIIVENCLRL
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  lllvflvlllflrslraalivllalplsllgalgllallgislnllslvglilliGlgvddaivlverir
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  lllifllllllfrslrlallallalplaligalgllallgiplsllslaglilliGiavddsillvdrir
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPMALTVLMALLG
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  eelr....eegl.....slreailealrergrpilltalttilgflplafsggaggpllrpfaltlalgl
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  eellregl..........dlreaiiealrrrlrpilltalttllgflplllstglgspflrgfalalaig
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ASLLSMTFVPAAVALMVTGKVSEKENWFMRLAHRTYVPLLDLAVRLRVVVAAAAVVLVIVSGYAATRMGG
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  llstllaltllPallall----------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  llvstlltlfllPallallgrrr-----------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EFIPSLDEGDVAIQAMRIPGTSLTQSLEMQMALEKRLLAIPEVKEAFARTGTAEVATDPMPPSISDGYVM
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  -----EDqgyllvlvqlPegaslerteavldeveeillelelpevesvfsvaGfsflgg...gsnagllf
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LKPRDQWPDPKKPKLEVMKEIETASEEVAGNLYELSQPIQLRFNELISGVRSDVGVKIFGDDLDVLAQVA
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  vtLkdwdeRkrkelsaaaiiarlrkklagipgarvfafnpPa----------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AQVQAILQTIKGAADVKTEQVAGLPVLTVKLDRQALARFGINVADVQSLVEIAVGGKSAGLVFEGDRRFD
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ------------------------pqlrveldpdklaalgltlsdvanalqaanvqvlggllvgtfllgg
00392472   2/2  ------------------------pqlrveldrdklaalglslsdvasalqaanggvpvgtlleggreyl
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LVVRLPDHLRTDVEAIKRLPIPLPPADGQAKATPAVFGNSPLAQMRYAPLAELAEISVSPGPNQISREDG
00392492   2/2  -------------------------------------------------------idlvlgpslisreng
00392482   2/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  reyevvvrad.glrlspedlenlvvrtn..................adgslvpLsdvAtve---------
00392472   2/2  vrvqadpglrlspedlenlvvrta..dg.................alvpLsdvAtvelgvg---------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           KRRIVVSANVRGRDLGSFVGEAQQLVAGKVKLPAGYWIGWGGQFEQLVSATERLTIVVPIALLLIFLLLF
00392492   2/2  kravlvrvnlrggdltseeavalalallagalpagvsvevggdleeq.........alllalllifllll
00392482   2/2  -----------gantgevvdavrallee..alpagvtvevtgvsadlieeaisdlllalllalllvflvl
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           ISLGSAADALLVFSGVPLALTGGIFALLLRGIPLSISAGIGFIALSGVAVLNGLVIITFIERLRGDGRKI
00392492   2/2  llfrslrlallallalplaligalgllallgiplsllslaglilliGiavddsillvdrireellregld
00392482   2/2  llflrslraalivllalplsllgalgllallgislnllslvglilliGlgvddaivlverireelreegl
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           VDAVREGALTRLRPVLMTALVASLGFVPMALATGAGAEVQRPLATVVIGGIVSSTILTLLVLPALYILFR
00392492   2/2  lreaiiealrrrlrpilltalttllgflplllstglgspflrgfalalaigllvstlltlfllPallall
00392482   2/2  slreailealrergrpilltalttilgflplafsggaggpllrpfaltlalglllstllaltllPallal
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           REASPAELAASSVPTKQGDH--------------------------------------------------
00392492   2/2  grrrek----------------------------------------------------------------
00392482   2/2  l---------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------
00474561   1/2  ----------------------------------------------------------------------
00474572   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------
00474562   2/2  ----------------------------------------------------------------------
00474571   1/2  ----------------------------------------------------------------------