[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39396.1


[Show Plain Result]

## Summary of Sequence Search
   1::313
  20::206  2.7e-50 37.6% 0045687 00456871 1/1   igase/mRNA capping enzyme, catalytic do 
   1::208  5.4e-47 34.7% 0048677 00486771 1/1   igase/mRNA capping enzyme, catalytic do 
  18::208  8.4e-46 35.9% 0046164 00461641 1/1   igase/mRNA capping enzyme, catalytic do 
  22::207    5e-37 35.5% 0046865 00468651 1/1   igase/mRNA capping enzyme, catalytic do 
  19::213  2.5e-34 32.3% 0050886 00508861 1/1   igase/mRNA capping enzyme, catalytic do 
 207::310  3.9e-15 34.0% 0045686 00456861 1/1   ic acid-binding proteins                
 208::309  1.5e-14 31.4% 0050885 00508851 1/1   ic acid-binding proteins                
   1::313


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKRARVVRIHAEGAVPAPMPGFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHD
00456871   1/1  -------------------lgipvkpmlaqpvslesleealldlgdylveeKlDGiRaqlhidgdgevrl
00486771   1/1  aldlldplaeellgvlpdllllallllllaellgavslglpgplppmLakksilelldgsdylveeKlDG
00461641   1/1  -----------------aealgldvlrledllldlelvveelldllvllelvklllgrpvkpfpaalavs
00468651   1/1  ---------------------gppkpmlasllkkvlelggdylveeKlDGira..yvdgd...lfsRgge
00508861   1/1  ------------------lelvvplkpmlallvsflkrilkllggkdylveeKlDGlrvqlvyedgklvr
00456861   1/1  ----------------------------------------------------------------------
00508851   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WSKMFAPLVAALSDAAVDEAVIDGEIVVVVDERTDFGALQADLAARRADRMLFYAFDLLHLDGYDLGPVP
00456871   1/1  fsRngeditalekfpelvdalrallkdalallvpgliLDGElvvldedggklsglllallllkdnfalpf
00486771   1/1  iRaqlhilldlkrgggvrlfsRngevfdvtglrfpelvdalkllalllpgtiLDGElv............
00461641   1/1  laeavlklldgedylveeKlDGiRvqvhilldedggevrlfsRngeditarfpelv....alllddtiLD
00468651   1/1  dita..pelvealkdlp..dliLdGElvvldkdfealqsrlrkkvsaakiplvflvFDllylnge....l
00508861   1/1  lftRggeditanfptivdiplkllledlpdlildGElvvldgeggfanpfnalagrlrqkdpkitakrpl
00456861   1/1  ----------------------------------------------------------------------
00508851   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKR
00456871   1/1  qalqgrlrrkspidkllekvplrflvFDllylnellegegedlldlplseRrelLeellleipgpl----
00486771   1/1  .vdkklleevplvflvFDllylngedlldlplseRralLeelvikplknllellpglleaalipprvr--
00461641   1/1  GElvvlded................vplrflvFDllylngedlldlpleeRralLeellleipgllle--
00468651   1/1  plserrelleellkpllgllelprlrlveliqllvsdleeleelleealdlglEGlvlKrldspYep---
00508861   1/1  rffafdllyldgedlldlplserlelLeelgfpvnpllrlvelievldleellellrealdygieGlvlK
00456861   1/1  ------------------------------------------------------------------pvle
00508851   1/1  -------------------------------------------------------------------vdt


                         -         -         -         +         -         -         -:280
query           EHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETAAPPIAKPPPRHRPR
00456871   1/1  ----------------------------------------------------------------------
00486771   1/1  ----------------------------------------------------------------------
00461641   1/1  ----------------------------------------------------------------------
00468651   1/1  ----------------------------------------------------------------------
00508861   1/1  vnd-------------------------------------------------------------------
00456861   1/1  qefvivGftrgkggranlgslvgllglledgrlvy....gtGlsealleeltellkeleldespfaapla
00508851   1/1  lDlvvvGayygkgkragllgslllgvydpedgelvsvgkvgtGfsdeelkellellkplvidkpppallv


                         -         *         -         -         -         -         +:350
query           WVRPVMSADVEYRDITASGHLRHASFKGLAKAP-------------------------------------
00456871   1/1  ----------------------------------------------------------------------
00486771   1/1  ----------------------------------------------------------------------
00461641   1/1  ----------------------------------------------------------------------
00468651   1/1  ----------------------------------------------------------------------
00508861   1/1  ----------------------------------------------------------------------
00456861   1/1  lgrnvvwvkplykGlvcevsfleltpdGsL----------------------------------------
00508851   1/1  lgklgpdvwvePslVlevkfaeltlsgry-----------------------------------------