[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39446.1


[Show Plain Result]

## Summary of Sequence Search
   1::281
   4::268    3e-80 43.8% 0045776 00457761 1/1   )-linked oxidoreductase                 
   3::268  7.3e-80 44.6% 0046225 00462251 1/1   )-linked oxidoreductase                 
   4::270  7.6e-80 45.2% 0049058 00490581 1/1   )-linked oxidoreductase                 
   5::268  2.4e-79 44.6% 0049299 00492991 1/1   )-linked oxidoreductase                 
   1::270  1.1e-78 42.5% 0048892 00488921 1/1   )-linked oxidoreductase                 
   3::268  1.1e-77 43.8% 0047570 00475701 1/1   )-linked oxidoreductase                 
   4::268  1.7e-77 43.0% 0046848 00468481 1/1   )-linked oxidoreductase                 
   4::268  3.4e-77 43.0% 0046098 00460981 1/1   )-linked oxidoreductase                 
   3::277  3.8e-76 42.6% 0048014 00480141 1/1   )-linked oxidoreductase                 
   3::270  6.1e-76 41.9% 0050262 00502621 1/1   )-linked oxidoreductase                 
   3::268  9.8e-76 44.6% 0051795 00517951 1/1   )-linked oxidoreductase                 
   3::268  4.4e-75 42.7% 0045771 00457711 1/1   )-linked oxidoreductase                 
   3::274  4.5e-75 39.8% 0048846 00488461 1/1   )-linked oxidoreductase                 
   3::268  5.1e-75 42.9% 0049985 00499851 1/1   )-linked oxidoreductase                 
   4::270  9.4e-75 42.8% 0048842 00488421 1/1   )-linked oxidoreductase                 
   2::268  1.5e-74 43.0% 0047367 00473671 1/1   )-linked oxidoreductase                 
  14::275  1.2e-72 42.0% 0047069 00470691 1/1   )-linked oxidoreductase                 
   2::270  1.8e-72 42.0% 0046647 00466471 1/1   )-linked oxidoreductase                 
   3::269  1.4e-71 41.6% 0048562 00485621 1/1   )-linked oxidoreductase                 
   2::270  2.2e-70 40.6% 0048247 00482471 1/1   )-linked oxidoreductase                 
   3::270  7.1e-70 41.6% 0047249 00472491 1/1   )-linked oxidoreductase                 
   1::281


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSWDTRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
00457761   1/1  ---eyrvlgntglkvpalglGtmrlgg...eealaavraaldaGinhiDtAdvYg.sEelvGealkellk
00462251   1/1  --meyrvlgntglkvpalglGtmrlgg...eeaiaavraaldaGinhiDtAdvYg.sEelvGealkelle
00490581   1/1  ---eyrrlgntglkvsalglGtmrlgd...eeaiaalraaldaGinfiDtAdvYg.sEelvGealkellk
00492991   1/1  ----yrrlgntglkvpalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYg.sEelvGealkellk
00488921   1/1  llmeyrvlgntglkvpalglGtmrlggldeeeavaavraaldaGinhiDtAdvYg.sEelvGealkellk
00475701   1/1  --meyrvlgntglkvsalglGtmrlgg...eeaiaavraaldaGinfiDtAdvYg.sEelvGealkellk
00468481   1/1  ---eyrvlgntglkvpalglGtmrlgd...eeavaavkaaldaGinhiDtAdvYg.sEelvGealkellk
00460981   1/1  ---eyrvlgntglkvpalglGtmrlgg...eealaavraaldaGinhiDtAdvYg.sEelvGealkellk
00480141   1/1  --meyrrlgntglkvsalglGtmtlggqldeeeaiaaldaaldaGinfiDtAdvYgvplsaellglsEel
00502621   1/1  --meyrvlgntglkvsalglGtmrlgg...eealaavraaldaGinliDtAdvYg.sEelvGealkellk
00517951   1/1  --meyrvlgntglkvpalglGtmrlgg...eeaiaavraaldaGinhiDtAdvYg.sEelvGealkellk
00457711   1/1  --lllmeyrvlgntglkvpalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYg.sEelvGealke
00488461   1/1  --meyrklgntglkvsalglGtmtlgglyggqvdeeealalldaaldaGinfiDtAdvYgnglsEellGe
00499851   1/1  --meyrvlgntglkvpalglGtmrlgd...eealaavraaldaGinhiDtAdvYg.sEelvGealkellk
00488421   1/1  ---eyrrlgnsglkvsalglGtmtlgglyllgaldeeealalldaaldaGinfiDtAdvYgdglsEellG
00473671   1/1  -lmeyrvlgntglkvsalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYg.sEelvGealkellk
00470691   1/1  -------------kvsalglGtmtlggaldeeeaialldaaldaGinfiDtAdvYgdglsEellGealke
00466471   1/1  -lmeyrrlgnsglkvsalglGtmtlgggqldeeealalldaaldaGinfiDtAdvYgdglsEellGealk
00485621   1/1  --lmeyrllgntglkvsalglGtmtlgglyldeeeaialldaaldlGinfiDtAdvYgnglsEellgeal
00482471   1/1  -lmeyrvlgntglkvsalglGtmrlgg...eealallraaldaGinliDtAdvYg.sEellGealkelgv
00472491   1/1  --meyrllgntglkvsalglGtmrlgg...eealallraaldaGinliDtAdvYg.sEellGealkelgv


                         -         -         *         -         -         -         -:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
00457761   1/1  esgvkRedlfiaTKlgptdlsrehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllls
00462251   1/1  eglgvpRedlfiatKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllll
00490581   1/1  esgvpredlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpvalkllelldplvpleetlea
00492991   1/1  esgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllll
00488921   1/1  esgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllll
00475701   1/1  esgvkRedlfiatKlgltdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllalllllllded
00468481   1/1  esgvkRedlfiaTKlgptdlsrehvraaleeslkrLgtdyiDlyliHwpdplklldlllpldedglllll
00460981   1/1  esgvkRedlfiaTKlgptdlsrehvraaleeslkrLgtdyiDlyliHwpdplklldlllpldedglllll
00480141   1/1  lGealkelgpRddlviaTKvgitlgdgpnllvllldlsrehiraaleaslkrLgtdyiDlyllHwpdalk
00502621   1/1  esgvpredlfiaTKlgltdlspehvraaleeslkrLgtdyiDlyllHwpdp.pleetlealeelvkeGkv
00517951   1/1  eglgvpRedlfiatKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllll
00457711   1/1  llkesgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgll
00488461   1/1  alkelgkrddlviaTKvgptlgdgvnlldlspehiraaleeslkrLgtdyiDlyllHrpdpltpleetle
00499851   1/1  esgvkRedlfiaTKlgltdlsrehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllll
00488421   1/1  ealkgvprddlviatKvglllldgpnlldlsrehiraaleeslkrLgtdyiDlyllHrpdpltpleetle
00473671   1/1  esgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllll
00470691   1/1  lgvprddlviaTKvglrnglglsrehiraaleasLkrLgtdyiDlyllHrpdpltpleetlealeelvke
00466471   1/1  elgvprddlviaTKvgilllglnlldlsrehiraaleaslkrLgtdyiDlyllHrpdpltpleetleale
00485621   1/1  kdlgvkRddlfiaTKvgillgdgpnllvllldlspehiraaleesLkrLgtdyiDlyllHrpdpltplee
00482471   1/1  predlfiaTKlg..dlspehvraaleeslkrLgtdyiDlyllHwpdpllvpleetlealeelvkeGkvra
00472491   1/1  predlfiaTKlgltdlspehvraaleeslkrLgtdyiDlyllhwpdpllvpleetlealeelvkeGkvra


                         +         -         -         -         -         *         -:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
00457761   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglvppavnqveynlllr..elellelcke
00462251   1/1  llvpleetlealeelvkeGkvraiGvSnfsaeqleellavak.ippavnqveynlllr..elellelcre
00490581   1/1  leelvkeGkvraiGvSnfsaeqleellalae.vppavnqveynlllr..erellelcrelgigvlaysPl
00492991   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllr..elellelcre
00488921   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllr..erellelcre
00475701   1/1  gllllslvpleetlealeelvkeGkvraiGvSnfsaeqleellalak.ippavnqveynlllr..elell
00468481   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellalaeglippvvnqveynlllr..elellelcke
00460981   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellalaeglippvvnqveynlllr..elellelcke
00480141   1/1  lldgllllllllllpltpleetlealeelvkeGkvryiGvSnfsaeqleealevaellglippvvnqvey
00502621   1/1  raiGvSnfsaeqleellelae.ippavnqveynlllr..elellelcrelgigvlaysPlggglltgkyd
00517951   1/1  slvpleetlealeelvkeGkvraiGvSnfsaeqleellavak.ippavnqveynlllr..elellelcre
00457711   1/1  llsltpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllr..elellel
00488461   1/1  aleelvkeGkiryiGvSnfsaeqleealelak...pvvvQveynlllrqaerellplcrelgigvlaysP
00499851   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllr..elellelcke
00488421   1/1  aleelvkeGkvryiGvSnfsaeqleealav...vppvvvqveynlllrqaerellplcrelgigvvaysP
00473671   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippvvnqveynlllr..elellelcre
00470691   1/1  GkvryiGvSnfsaeqleealavaeklglvppvvnqveynlllrqaerellplcrelgigvvaysPlagGl
00466471   1/1  elvkeGkvryiGvSnfsaeqleealavaellglvppvvvqveynlllrqalelellplcrelgigvvays
00485621   1/1  tlealeelvkeGkvryiGvSnfsaeqleealalagvppvvnqqelyplllreaelellplcrelgigvla
00482471   1/1  iGvSnfsaeqleellela...pivpvqnqynllprlaerellelcrelgigvlaysPlggglllgkyd..
00472491   1/1  iGvSnfsaeqleellela...pivpvqnqynllprlaerellelcrelgigvlaysPlggglllgkyd..


                         -         -         -         +         -         -         -:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKAADAAHAADNAAAASLRLSDEEIAAIDQAFPLGPEPASLPM
00457761   1/1  lgigvlaysPlggglltgkyldgallledevlkeiakkhgvtpaqvalawllqrgvv.------------
00462251   1/1  lgigvlaysPlggglltgkyldgallledevlkeiakkhgvtpaqvalawllqrgvv.------------
00490581   1/1  ggGlltgkylsgllfllelleallllvevlkeiakkhgvtpaqvalawllqrpvv.vipg----------
00492991   1/1  lgigvlaysPlggglltgkylpgapllllvevlkeiakkhgvtpaqvalawllqrpvv------------
00488921   1/1  lgigvlaysPlggglltgkylpgapllllvevlkeiakkhgvspaqvalawllqrpvv.v----------
00475701   1/1  elckelgigvlaysPlggglltgkylggalpeallllvevlkeiakkhgvtpaqvala------------
00468481   1/1  lgigvlaysPlggglltgkyldgpllllvpvlkeiakkhgvtpaqvalawllqrgvv.------------
00460981   1/1  lgigvlaysPlggglltgkyldgalllllpvlkeiaekhgvtpaqvalawllqrgvv.------------
00480141   1/1  nlllrqaerellplcrelgigvlaysPlagGlLtgkylsgalpdgdlrrllprflrelleallllve---
00502621   1/1  ...evlkeiaeklgvspaqvalawllqrgvv.vipgassperleenlaaldfelseeela----------
00517951   1/1  lgigvlaysPlggglltgkyldgallledevlkeiaekhgvtpaqvalawllqrgvv.------------
00457711   1/1  ckelgigvlaysPlggglltgkylsgapllllvevlkeiakkhgvtpaqvalawllqr------------
00488461   1/1  lagGlLtgkyldgalpdsgdlrsllplfldelleellelvealeeiaklkhgvspaqvalawll------
00499851   1/1  lgigvlaysPlggglltgkyldgaalllvpvlkeiakkhgvtpaqvalawllqrgvv.------------
00488421   1/1  lagGlltgkylsgallasgdlrlllprflrelleallllvealkeiaekhgvtpaqvala----------
00473671   1/1  lgigvlaysPlggglltgkylpgapllllvevlkeiakkhgvspaqvalawllqrpvv------------
00470691   1/1  Ltgkylsgallasgdlrlllasllllllllprflrelleallllvealaeiaeklgvspaqvala-----
00466471   1/1  PlagGlLtgkyldglllasgrllldlrlllprflgelleallllvealaeiakkhgvtpa----------
00485621   1/1  ysPlagglltgkylsgllllevlkeiakkhgvtpaqvalawllqrpavtvvipgasspe-----------
00482471   1/1  .evlkeiaeklgvspaqvalawllqrgvv.vipgassperleenlaaldfelseeelaal----------
00472491   1/1  .evlkeiaeklgvspaqvalawllqrpav.vipgassperleenlaaldlelsdeelaal----------


                         -         *         -         -         -         -         +:350
query           L---------------------------------------------------------------------
00457761   1/1  ----------------------------------------------------------------------
00462251   1/1  ----------------------------------------------------------------------
00490581   1/1  ----------------------------------------------------------------------
00492991   1/1  ----------------------------------------------------------------------
00488921   1/1  ----------------------------------------------------------------------
00475701   1/1  ----------------------------------------------------------------------
00468481   1/1  ----------------------------------------------------------------------
00460981   1/1  ----------------------------------------------------------------------
00480141   1/1  ----------------------------------------------------------------------
00502621   1/1  ----------------------------------------------------------------------
00517951   1/1  ----------------------------------------------------------------------
00457711   1/1  ----------------------------------------------------------------------
00488461   1/1  ----------------------------------------------------------------------
00499851   1/1  ----------------------------------------------------------------------
00488421   1/1  ----------------------------------------------------------------------
00473671   1/1  ----------------------------------------------------------------------
00470691   1/1  ----------------------------------------------------------------------
00466471   1/1  ----------------------------------------------------------------------
00485621   1/1  ----------------------------------------------------------------------
00482471   1/1  ----------------------------------------------------------------------
00472491   1/1  ----------------------------------------------------------------------