[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39447.1


[Show Plain Result]

## Summary of Sequence Search
   1::315
 199::303  5.4e-14 17.1% 0043518 00435182 2/2   drug resistance efflux transporter EmrE 
  59::164    1e-13 26.7% 0043518 00435181 1/2   drug resistance efflux transporter EmrE 
   1::315


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTITSPPVTDAARRLTQRHADHPLRGIALIVASTVFLACSDTLAKYLGRTLPPIEIGWIRFLVFLLIMLP
00435182   2/2  ----------------------------------------------------------------------
00435181   1/2  ----------------------------------------------------------lrlllaallllp


                         -         -         *         -         -         -         -:140
query           VALASSESPLRSVRPKLQVLRALALVASSVLFITGLRFLPIAEASATSFVAPLFVTALSIVLLGEAIGIR
00435182   2/2  ----------------------------------------------------------------------
00435181   1/2  falllkls.pgrtwllllllgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsl


                         +         -         -         -         -         *         -:210
query           RWVATLVGLIGVLIVIRPGSSTFNPAVILPILSALCWAITLILTRMISGADRAVVTMTFSALVGFLALSA
00435182   2/2  ----------------------------------------------------------lrlllaallllp
00435181   1/2  lqllGialilaGvlllllggrrrk----------------------------------------------


                         -         -         -         +         -         -         -:280
query           MVPFVWVTPSWTDIAIGVGVGLASTIGQWIVVLAFRYADASALAPFSYSQLLWVTILGYAVFSEIPDAWT
00435182   2/2  falllklspgrtwllllllgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsll
00435181   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FVGAVVIICSGVYIAHRERLRRKQNVAPAEPNPNP-----------------------------------
00435182   2/2  qllGialilaGvlllllggrrrk-----------------------------------------------
00435181   1/2  ----------------------------------------------------------------------